Animal-Free IL-8/CXCL8 Protein, Pig (His)

IL-8/CXCL8 protein, a vital chemotactic factor, orchestrates inflammatory responses by attracting neutrophils, basophils, and T-cells to clear pathogens. It activates neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. IL-8/CXCL8 homodimerizes, disrupted by tick evasin-3, and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. Animal-Free IL-8/CXCL8 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-8/CXCL8 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-8/CXCL8 Protein, Pig (His) is 78 a.a., with molecular weight of ~10.04 kDa.

IL-8/CXCL8 protein serves as a pivotal chemotactic factor, playing a central role in mediating inflammatory responses by attracting neutrophils, basophils, and T-cells to effectively clear pathogens and protect the host from infections. It also contributes significantly to neutrophil activation. Released in response to inflammatory stimuli, IL-8/CXCL8 exerts its effects by binding to G-protein-coupled receptors CXCR1 and CXCR2, primarily found in neutrophils, monocytes, and endothelial cells. The G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to CXCR1/CXCR2 receptors, and activation by IL-8 leads to the release of beta and gamma subunits from Galpha (GNAI2 in neutrophils) and subsequent activation of downstream signaling pathways, including PI3K and MAPK pathways. IL-8/CXCL8 forms homodimers, and this dimerization is disrupted by tick evasin-3. Furthermore, IL-8/CXCL8 interacts with TNFAIP6 via its Link domain, and this interaction interferes with chemokine binding to glycosaminoglycans, suggesting a regulatory role in modulating chemokine activity within the inflammatory microenvironment.

Pig

E. coli

C-His

CAA43461 (A26-Q103)

396880  [NCBI]

MARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ

Approximately 10.04 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.