1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-9
  5. Animal-Free IL-9 Protein, Human (His)

IL-9 protein, secreted by T-helper 2 lymphocytes, mast cells, or NKT cells, regulates immune response against parasites, intestinal permeability, and adaptive immunity. It induces differentiation of TH17 cells and mast cell proliferation through IL9R and IL2RG receptor stimulation, activating JAK1, JAK3, STAT1, STAT3, and STAT5. IL-9's diverse effects are mediated by its interaction with IL9R subunit and IL2RG. Animal-Free IL-9 Protein, Human (His) is the recombinant human-derived animal-FreeIL-9 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free IL-9 Protein, Human (His) is 126 a.a., with molecular weight of ~14.93 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-9 protein, secreted by T-helper 2 lymphocytes, mast cells, or NKT cells, regulates immune response against parasites, intestinal permeability, and adaptive immunity. It induces differentiation of TH17 cells and mast cell proliferation through IL9R and IL2RG receptor stimulation, activating JAK1, JAK3, STAT1, STAT3, and STAT5. IL-9's diverse effects are mediated by its interaction with IL9R subunit and IL2RG. Animal-Free IL-9 Protein, Human (His) is the recombinant human-derived animal-FreeIL-9 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free IL-9 Protein, Human (His) is 126 a.a., with molecular weight of ~14.93 kDa.

Background

IL-9 protein, a multifunctional cytokine primarily secreted by T-helper 2 lymphocytes, mast cells, or NKT cells, plays crucial roles in the immune response against parasites. Its impact extends to intestinal epithelial permeability and adaptive immunity. IL-9 further contributes to the differentiation of specific T-cell subsets, including IL-17 producing helper T-cells (TH17), and promotes the proliferation and differentiation of mast cells. Functionally, IL-9 exerts its biological effects through a receptor composed of the IL9R subunit and the signal transducing subunit IL2RG. Receptor stimulation rapidly activates JAK1 and JAK3 kinase activities, leading to STAT1, STAT3, and STAT5-mediated transcriptional programs. While the induction of differentiation genes appears to be mediated by STAT1 alone, the protection of cells from apoptosis depends on STAT3 and STAT5. IL-9 interacts with the IL9R subunit and IL2RG, forming a molecular basis for its diverse cellular effects.

Biological Activity

Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is <0.25 ng/mL. The specific activity of recombinant human IL-9 is approximately >5 x106 IU/ mg

Species

Human

Source

E. coli

Tag

N-His

Accession

P15248 (Q19-I144)

Gene ID
Molecular Construction
N-term
His
IL-9 (Q19-I144)
Accession # P15248
C-term
Synonyms
Interleukin-9; IL-9; Cytokine P40; T-Cell Growth Factor P40; IL9
AA Sequence

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Molecular Weight

Approximately 14.93 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.01 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-9 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-9 Protein, Human (His)
Cat. No.:
HY-P700134AF
Quantity:
MCE Japan Authorized Agent: