1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. IP-10/CXCL10
  6. Animal-Free IP-10/CXCL10 Protein, Pig (His)

Animal-Free IP-10/CXCL10 Protein, Pig (His)

Cat. No.: HY-P700232AF
SDS COA Handling Instructions Technical Support

The IP-10/CRG-2/CXCL10 protein is part of the intercrine α family and functions as a chemokine involved in intercellular communication and immune responses. Further studies may contribute to the regulation of inflammatory processes and cellular interactions and will be critical to uncovering specific functions and effects within the broader CxC family of chemokines. Animal-Free IP-10/CXCL10 Protein, Pig (His) is the recombinant pig-derived animal-FreeIP-10/CRG-2/CXCL10 protein, expressed by E. coli , with N-His labeled tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IP-10/CRG-2/CXCL10 protein is part of the intercrine α family and functions as a chemokine involved in intercellular communication and immune responses. Further studies may contribute to the regulation of inflammatory processes and cellular interactions and will be critical to uncovering specific functions and effects within the broader CxC family of chemokines. Animal-Free IP-10/CXCL10 Protein, Pig (His) is the recombinant pig-derived animal-FreeIP-10/CRG-2/CXCL10 protein, expressed by E. coli , with N-His labeled tag.

Background

The IP-10/CRG-2/CXCL10 protein is a member of the intercrine alpha (chemokine CxC) family, emphasizing its role within a group of chemokines implicated in intercellular communication and immune responses. As part of the intercrine alpha family, IP-10/CRG-2/CXCL10 likely contributes to the modulation of inflammatory processes and cellular interactions. Further investigation is essential to unveil the specific functions and implications of this protein within the broader framework of the chemokine CxC family.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with Human CXCR2.The ED50 for this effect is <4 ng/mL.

Species

Pig

Source

E. coli

Tag

N-His

Accession

Q5S1S3 (P23-A104)

Gene ID
Synonyms
CXCL10; C-X-C motif chemokine 10; Gamma-IP10; IP-10; Mob1; Scyb10
AA Sequence

PLSRTVRCTCIKISDRPVNPRSLEKLEMIPASQSCPHVEIIATMKKNGEKRCLNPESKTIKNLLKAISKERSKRSPRTQREA

Molecular Weight

Approximately 10.13 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IP-10/CXCL10 Protein, Pig (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IP-10/CXCL10 Protein, Pig (His)
Cat. No.:
HY-P700232AF
Quantity:
MCE Japan Authorized Agent: