1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. CXCL9
  6. Animal-Free MIG/CXCL9 Protein, Human (His)

MIG, also known as CXCL9 protein, occurs as a cytokine that affects the growth, movement, or activation state of cells involved in immune and inflammatory responses. Specifically, it acts as a potent chemoattractant for activated T cells, coordinating their migration. Animal-Free MIG/CXCL9 Protein, Human (His) is the recombinant human-derived animal-FreeMIG/CXCL9 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free MIG/CXCL9 Protein, Human (His) is 103 a.a., with molecular weight of ~12.53 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MIG, also known as CXCL9 protein, occurs as a cytokine that affects the growth, movement, or activation state of cells involved in immune and inflammatory responses. Specifically, it acts as a potent chemoattractant for activated T cells, coordinating their migration. Animal-Free MIG/CXCL9 Protein, Human (His) is the recombinant human-derived animal-FreeMIG/CXCL9 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free MIG/CXCL9 Protein, Human (His) is 103 a.a., with molecular weight of ~12.53 kDa.

Background

MIG, also known as CXCL9 protein, emerges as a cytokine exerting influence on the growth, movement, or activation state of cells involved in immune and inflammatory responses. Specifically, it acts as a potent chemoattractant for activated T-cells, orchestrating their migration. MIG achieves its effects by binding to CXCR3, thereby contributing to the intricate regulation of immune cell behavior, particularly in the context of inflammatory reactions and immune system modulation.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR3. The ED50 for this effect is <0.5 μg/mL.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q07325 (T23-T125)

Gene ID
Molecular Construction
N-term
His
CXCL9 (T23-T125)
Accession # Q07325
C-term
Synonyms
MIG/CXCL9; C-X-C motif chemokine 9; SCYB9
AA Sequence

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Molecular Weight

Approximately 12.53 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free MIG/CXCL9 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free MIG/CXCL9 Protein, Human (His)
Cat. No.:
HY-P700050AF
Quantity:
MCE Japan Authorized Agent: