1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MIP-1 alpha/CCL3
  6. Animal-Free MIP-1 alpha/CCL3 Protein, Human (His)

Animal-Free MIP-1 alpha/CCL3 Protein, Human (His)

Cat. No.: HY-P7256AF
SDS COA Handling Instructions Technical Support

MIP-1 alpha/CCL3 protein, a monokine with inflammatory and chemokinetic properties, binds to CCR1, CCR4, and CCR5 receptors. Produced by CD8+ T-cells, it inhibits various strains of HIV-1, HIV-2, and SIV in a dose-dependent manner. Additionally, MIP-1 alpha/CCL3 self-associates and forms a heterodimer with MIP-1-beta(3-69). Animal-Free MIP-1 alpha/CCL3 Protein, Human (His) is the recombinant human-derived animal-FreeMIP-1 alpha/CCL3 protein, expressed by E. coli , with N-His. The total length of Animal-Free MIP-1 alpha/CCL3 Protein, Human (His) is 66 a.a., with molecular weight of ~7.43 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MIP-1 alpha/CCL3 protein, a monokine with inflammatory and chemokinetic properties, binds to CCR1, CCR4, and CCR5 receptors. Produced by CD8+ T-cells, it inhibits various strains of HIV-1, HIV-2, and SIV in a dose-dependent manner. Additionally, MIP-1 alpha/CCL3 self-associates and forms a heterodimer with MIP-1-beta(3-69). Animal-Free MIP-1 alpha/CCL3 Protein, Human (His) is the recombinant human-derived animal-FreeMIP-1 alpha/CCL3 protein, expressed by E. coli , with N-His. The total length of Animal-Free MIP-1 alpha/CCL3 Protein, Human (His) is 66 a.a., with molecular weight of ~7.43 kDa.

Background

MIP-1 alpha/CCL3 protein, a monokine with inflammatory and chemokinetic properties, exhibits binding affinity to CCR1, CCR4, and CCR5 receptors. This protein, a major HIV-suppressive factor produced by CD8+ T-cells, demonstrates a dose-dependent inhibition of various strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). MIP-1 alpha/CCL3 self-associates and forms a heterodimer with MIP-1-beta(3-69).

Biological Activity

The ED50 is <10 ng/mL as measure by its ability to chemoattract BaF3 cells transfected with human CCR5.

Species

Human

Source

E. coli

Tag

N-His

Accession

P10147 (A27-A92)

Gene ID
Molecular Construction
N-term
His
CCL3 (A27-A92)
Accession # P10147
C-term
Synonyms
MIP-1a: Macrophage Inflammatory Protein-1α; LD78α
AA Sequence

ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Molecular Weight

8-11 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free MIP-1 alpha/CCL3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free MIP-1 alpha/CCL3 Protein, Human (His)
Cat. No.:
HY-P7256AF
Quantity:
MCE Japan Authorized Agent: