Animal-Free MIP-1 alpha/CCL3 Protein, Mouse (His)

MIP-1 alpha/CCL3 protein, a monokine, displays inflammatory, pyrogenic, and chemokinetic properties.It induces potent chemotaxis in eosinophils and activates calcium release in neutrophils via high-affinity receptor binding.Animal-Free MIP-1 alpha/CCL3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-1 alpha/CCL3 protein, expressed by E.coli , with N-His, N-His labeled tag.

MIP-1 alpha/CCL3 protein, a monokine, possesses inflammatory, pyrogenic, and chemokinetic properties. It exhibits potent chemotactic activity for eosinophils and, upon binding to a high-affinity receptor, triggers calcium release in neutrophils.

Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED₅₀ for this effect is <1.8 ng/mL.

Mouse

E. coli

N-His;N-His

P10855 (A24-A92)

20302  [NCBI]

APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Approximately 8.69 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.