1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. MIP-2/GRO-beta
  6. Animal-Free MIP-2/CXCL2 Protein, Mouse (His)

Animal-Free MIP-2/CXCL2 Protein, Mouse (His)

Cat. No.: HY-P700171AF
SDS COA Handling Instructions

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.

Background

MIP-2/CXCL2 protein acts as a chemotactic factor specifically for human polymorphonuclear leukocytes, with the distinctive characteristic of not inducing chemokinesis or an oxidative burst in these cells. Its chemotactic function underscores its role in orchestrating the directed migration of polymorphonuclear leukocytes, contributing to their recruitment to specific sites in response to inflammatory signals. Notably, MIP-2/CXCL2 exists as a homotetramer, emphasizing its structural composition and potential implications for its biological activity in the regulation of immune responses and inflammatory processes.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <0.5 ng/mL.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P10889 (A28-N100)

Gene ID
Molecular Construction
N-term
His
CXCL2 (A28-N100)
Accession # P10889
C-term
Synonyms
rMuMIP-2/CXCL2; C-X-C motif chemokine 2; SCYB2
AA Sequence

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Weight

Approximately 8.66 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free MIP-2/CXCL2 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free MIP-2/CXCL2 Protein, Mouse (His)
Cat. No.:
HY-P700171AF
Quantity:
MCE Japan Authorized Agent: