1. Recombinant Proteins
  2. Animal-free Recombinant Proteins
  3. Animal-Free Nodal Protein, Human (His)

Animal-Free Nodal Protein, Human (His)

Cat. No.: HY-P700025AF
COA Handling Instructions

Nodal protein plays a key role in embryonic development and is indispensable for mesoderm formation and axial patterning. As a homodimer linked together by disulfide bonds, Nodal helps form the molecular framework that controls fundamental developmental pathways, ensuring the correct establishment of mesodermal tissue and axial structure during embryogenesis. Animal-Free Nodal Protein, Human (His) is the recombinant human-derived animal-FreeNodal protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free Nodal Protein, Human (His) is 110 a.a., with molecular weight of ~13.75 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $83 In-stock
10 μg $232 In-stock
50 μg $648 In-stock
100 μg $1100 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Animal-Free Nodal Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Nodal protein plays a key role in embryonic development and is indispensable for mesoderm formation and axial patterning. As a homodimer linked together by disulfide bonds, Nodal helps form the molecular framework that controls fundamental developmental pathways, ensuring the correct establishment of mesodermal tissue and axial structure during embryogenesis. Animal-Free Nodal Protein, Human (His) is the recombinant human-derived animal-FreeNodal protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free Nodal Protein, Human (His) is 110 a.a., with molecular weight of ~13.75 kDa.

Background

Nodal protein plays a pivotal role in embryonic development, serving as an indispensable factor for both mesoderm formation and axial patterning. As a homodimer held together by disulfide linkages, Nodal contributes to the molecular framework that governs essential developmental pathways, ensuring the proper establishment of mesodermal tissues and axial structures during embryogenesis. This protein, free from animal-derived components, underscores its suitability for applications demanding stringent purity and ethical considerations in research and biotechnological endeavors.

Biological Activity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <2.2 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q96S42 (H238-L347)

Gene ID
Molecular Construction
N-term
Nodal (H238-L347)
Accession # Q96S42
His
C-term
Synonyms
Nodal
AA Sequence

MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL

Molecular Weight

Approximately 13.75 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free Nodal Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free Nodal Protein, Human (His)
Cat. No.:
HY-P700025AF
Quantity:
MCE Japan Authorized Agent: