Animal-Free Noggin Protein, Human (His)

Noggin protein is an important BMP inhibitor that plays an indispensable role in the neural tube, somite growth, cartilage morphogenesis, and joint formation. Its homodimeric structure promotes significant interactions with GDF5 and possibly GDF6, inhibiting chondrocyte differentiation. Animal-Free Noggin Protein, Human (His) is the recombinant human-derived animal-FreeNoggin protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free Noggin Protein, Human (His) is 205 a.a., with molecular weight of ~24 kDa.

Noggin protein emerges as a crucial inhibitor in the intricate realm of bone morphogenetic proteins (BMP) signaling, playing indispensable roles in neural tube and somite growth, as well as contributing to the intricate processes of cartilage morphogenesis and joint formation. Operating through its homodimeric structure, Noggin establishes a significant interaction with GDF5, and likely GDF6, exerting its inhibitory influence on chondrocyte differentiation. This molecular interplay underscores Noggin's pivotal position in regulating key aspects of embryonic development, emphasizing its nuanced involvement in sculpting the intricate patterns and structures critical for proper growth and morphogenesis.

Measure by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <0.05 µg/mL in the presence of 50 ng/mL of recombinant human BMP-4.

Human

E. coli

C-His

Q13253 (Q28-C232)

9241  [NCBI]

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Approximately 24 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 0.1% sarkosyl in 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.