Animal-Free OX40 Ligand/TNFSF4 Protein, Mouse (His)

The OX40 ligand/TNFSF4 protein is a cytokine that selectively binds to TNFRSF4 and serves as a key costimulator for T cell proliferation and cytokine production.As a homotrimer, this ligand plays a key role in modulating immune responses, particularly in enhancing T cell activation and function.Animal-Free OX40 Ligand/TNFSF4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeOX40 Ligand/TNFSF4 protein, expressed by E.coli , with N-His labeled tag.

OX40 Ligand/TNFSF4 protein, a cytokine, selectively binds to TNFRSF4, functioning as a critical co-stimulator for T-cell proliferation and cytokine production. Operating as a homotrimer, this ligand plays a key role in regulating immune responses, particularly in enhancing the activation and function of T-cells. Its engagement with TNFRSF4 highlights its significance as a molecular trigger for robust and targeted T-cell responses, contributing to the intricate orchestration of the immune system.

Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED₅₀ for this effect is <25 ng/mL.

Mouse

E. coli

N-His

P43488 (S51-L198)

22164  [NCBI]

QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL

Approximately 17.68 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.