1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Animal-free Recombinant Proteins
  3. TNF Superfamily T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands RANKL/CD254
  5. RANKL/CD254
  6. Animal-Free RANK L/TNFSF11 Protein, Human (His)

Animal-Free RANK L/TNFSF11 Protein, Human (His)

Cat. No.: HY-P700147AF
Handling Instructions Technical Support

RANK L/TNFSF11 protein is a cytokine that binds to TNFRSF11B/OPG and TNFRSF11A/RANK and serves as a key regulator of osteoclast differentiation and activation. In addition, it is a factor that enhances the ability of dendritic cells to stimulate naive T cell proliferation, indicating its importance in regulating the interaction between T cells and dendritic cells, as well as its potential role in T cell-dependent immune responses. Animal-Free RANK L/TNFSF11 Protein, Human (His) is the recombinant human-derived animal-FreeRANK L/TNFSF11 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free RANK L/TNFSF11 Protein, Human (His) is 175 a.a., with molecular weight of ~20.67 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RANK L/TNFSF11 protein is a cytokine that binds to TNFRSF11B/OPG and TNFRSF11A/RANK and serves as a key regulator of osteoclast differentiation and activation. In addition, it is a factor that enhances the ability of dendritic cells to stimulate naive T cell proliferation, indicating its importance in regulating the interaction between T cells and dendritic cells, as well as its potential role in T cell-dependent immune responses. Animal-Free RANK L/TNFSF11 Protein, Human (His) is the recombinant human-derived animal-FreeRANK L/TNFSF11 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free RANK L/TNFSF11 Protein, Human (His) is 175 a.a., with molecular weight of ~20.67 kDa.This product is for cell culture use only.

Background

RANK L/TNFSF11 protein, a cytokine, binds to TNFRSF11B/OPG and TNFRSF11A/RANK, functioning as a crucial regulator of osteoclast differentiation and activation. Additionally, it serves as a factor that enhances the ability of dendritic cells to stimulate naive T-cell proliferation, suggesting its importance in the regulation of T-cell and dendritic cell interactions, and a potential role in the T-cell-dependent immune response. Moreover, RANK L/TNFSF11 may play a significant role in enhanced bone resorption observed in conditions like humoral hypercalcemia of malignancy. Its induction of osteoclastogenesis involves the activation of multiple signaling pathways in osteoclast precursor cells, with a key mechanism being the induction of long-lasting oscillations in intracellular calcium concentration, leading to the activation of NFATC1. This transcription factor translocates to the nucleus and initiates osteoclast-specific gene transcription, facilitating osteoclast differentiation. During this process, RANK L/TNFSF11, in a TMEM64 and ATP2A2-dependent manner, induces CREB1 activation and mitochondrial ROS generation, crucial for proper osteoclast formation. Existing as a homotrimer, RANK L/TNFSF11 interacts with TNFRSF11B, TNFRSF11A, FBN1, and TNFAIP6, highlighting its versatile interactions in diverse cellular contexts.

Biological Activity

Measure by its ability to induce osteoclast differentiation in RAW264.7 cells. The ED50 for this effect is <10 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

O14788 (E143-D317)

Gene ID
Molecular Construction
N-term
RANKL (E143-D317)
Accession # O14788
His
C-term
Synonyms
soluble Receptor Activator of NF-kB Ligand; TNFSF11; TRANCE (TNF-Related Activation-induced Cytokine); OPGL; ODF (Osteoclast Differentiation Factor); CD254; sRNAK Ligand
AA Sequence

MEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Molecular Weight

Approximately 20.67 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free RANK L/TNFSF11 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free RANK L/TNFSF11 Protein, Human (His)
Cat. No.:
HY-P700147AF
Quantity:
MCE Japan Authorized Agent: