Animal-Free RSPO1/R-spondin-1 Protein, Human (243a.a, HEK293, His, SUMO)

RSPO1 or R-spondin-1 activates the canonical Wnt pathway through ligand binding to the LGR4-6 receptor, forming a complex with phosphorylated LRP6 and Frizzled receptors. This interaction upregulates target gene expression. Animal-Free RSPO1/R-spondin-1 Protein, Human (243a.a, HEK293, His, SUMO) is the recombinant human-derived animal-FreeRSPO1/R-spondin-1 protein, expressed by HEK293 , with N-His, N-SUMO labeled tag. The total length of Animal-Free RSPO1/R-spondin-1 Protein, Human (243a.a, HEK293, His, SUMO) is 243 a.a., with molecular weight of ~65 kDa.

RSPO1, also known as R-spondin-1, serves as an activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5, or LGR6), the resulting complex associates with phosphorylated LRP6 and frizzled receptors, activated by extracellular Wnt receptors. This interaction triggers the canonical Wnt signaling pathway, leading to an upregulation of target gene expression. Additionally, RSPO1 plays a role in modulating the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by inhibiting ZNRF3, a crucial regulator in the Wnt pathway. Acting as a ligand for frizzled FZD8 and LRP6, RSPO1 also negatively regulates the TGF-beta pathway and has essential functions in ovary determination. Furthermore, RSPO1 regulates Wnt signaling by counteracting DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1. The protein interacts with the extracellular domain of FZD8 and LRP6, forms a complex with RNF43, LGR5, and RSPO1, and binds heparin. RSPO1's interactions with ZNRF3 facilitate the membrane clearance of ZNRF3, contributing to its multifaceted role in Wnt pathway regulation.

R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The ED₅₀ for this effect is 1-3 μg/mL.

Human

HEK293

N-SUMO

Q2MKA7-1 (S21-A263)

284654  [NCBI]

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Approximately 65 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 10 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.