1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β TGF-β
  5. TGF-β1
  6. Animal-Free TGF beta 1/TGFB1 Protein, Pig (His)

Animal-Free TGF beta 1/TGFB1 Protein, Pig (His)

Cat. No.: HY-P700251AF
Handling Instructions Technical Support

TGFB1 proprotein is the precursor of latency-associated peptide (LAP) and active transforming growth factor Beta-1 (TGF-β-1) chain, which maintains TGF-β-1 latency in the extracellular matrix. TGFB1 binds non-covalently to TGF-β-1 and regulates its activation through interactions with “environmental molecules” (LTBP1, LRRC32/GARP, LRRC33/NRROS). Animal-Free TGF beta 1/TGFB1 Protein, Pig (His) is the recombinant pig-derived animal-FreeTGF beta 1/TGFB1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free TGF beta 1/TGFB1 Protein, Pig (His) is 112 a.a., with molecular weight of ~13.7 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TGFB1 proprotein is the precursor of latency-associated peptide (LAP) and active transforming growth factor Beta-1 (TGF-β-1) chain, which maintains TGF-β-1 latency in the extracellular matrix. TGFB1 binds non-covalently to TGF-β-1 and regulates its activation through interactions with “environmental molecules” (LTBP1, LRRC32/GARP, LRRC33/NRROS). Animal-Free TGF beta 1/TGFB1 Protein, Pig (His) is the recombinant pig-derived animal-FreeTGF beta 1/TGFB1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free TGF beta 1/TGFB1 Protein, Pig (His) is 112 a.a., with molecular weight of ~13.7 kDa.This product is for cell culture use only.

Background

The Transforming Growth Factor Beta-1 (TGFB1) proprotein serves as the precursor for both the Latency-associated peptide (LAP) and the active Transforming Growth Factor Beta-1 (TGF-beta-1) chains, constituting the regulatory and active subunit of TGF-beta-1, respectively. It plays a crucial role in maintaining the TGF-beta-1 chain in a latent state during storage in the extracellular matrix. TGFB1 associates non-covalently with TGF-beta-1 and regulates its activation through interactions with 'milieu molecules', such as LTBP1, LRRC32/GARP, and LRRC33/NRROS, controlling the activation of TGF-beta-1. Notably, the interaction with LRRC33/NRROS regulates activation of TGF-beta-1 in macrophages and microglia, while the interaction with LRRC32/GARP controls activation on the surface of activated regulatory T-cells (Tregs). Additionally, the interaction of TGFB1 with integrins (ITGAV:ITGB6 or ITGAV:ITGB8) induces distortion of the Latency-associated peptide chain, leading to the subsequent release of the active TGF-beta-1.

Biological Activity

Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells.The ED50 for this effect is<0.1 ng/mL.

Species

Pig

Source

E. coli

Tag

C-His

Accession

P07200 (A279-S390)

Gene ID
Molecular Construction
N-term
TGFB1 (A279-S390)
Accession # P07200
His
C-term
Synonyms
Differentiation inhibiting factor; Cartilage-inducing factor
AA Sequence

MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Weight

Approximately 13.7 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 10 mM HCl. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free TGF beta 1/TGFB1 Protein, Pig (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free TGF beta 1/TGFB1 Protein, Pig (His)
Cat. No.:
HY-P700251AF
Quantity:
MCE Japan Authorized Agent: