Animal-Free TGF beta 1/TGFB1 Protein, Pig (His)

TGFB1 proprotein is the precursor of latency-associated peptide (LAP) and active transforming growth factor Beta-1 (TGF-β-1) chain, which maintains TGF-β-1 latency in the extracellular matrix. TGFB1 binds non-covalently to TGF-β-1 and regulates its activation through interactions with “environmental molecules” (LTBP1, LRRC32/GARP, LRRC33/NRROS). Animal-Free TGF beta 1/TGFB1 Protein, Pig (His) is the recombinant pig-derived animal-FreeTGF beta 1/TGFB1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free TGF beta 1/TGFB1 Protein, Pig (His) is 112 a.a., with molecular weight of ~13.7 kDa.

The Transforming Growth Factor Beta-1 (TGFB1) proprotein serves as the precursor for both the Latency-associated peptide (LAP) and the active Transforming Growth Factor Beta-1 (TGF-beta-1) chains, constituting the regulatory and active subunit of TGF-beta-1, respectively. It plays a crucial role in maintaining the TGF-beta-1 chain in a latent state during storage in the extracellular matrix. TGFB1 associates non-covalently with TGF-beta-1 and regulates its activation through interactions with 'milieu molecules', such as LTBP1, LRRC32/GARP, and LRRC33/NRROS, controlling the activation of TGF-beta-1. Notably, the interaction with LRRC33/NRROS regulates activation of TGF-beta-1 in macrophages and microglia, while the interaction with LRRC32/GARP controls activation on the surface of activated regulatory T-cells (Tregs). Additionally, the interaction of TGFB1 with integrins (ITGAV:ITGB6 or ITGAV:ITGB8) induces distortion of the Latency-associated peptide chain, leading to the subsequent release of the active TGF-beta-1.

Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells.The ED₅₀ for this effect is<0.1 ng/mL.

Pig

E. coli

C-His

P07200 (A279-S390)

397078  [NCBI]

MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Approximately 13.7 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 10 mM HCl.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.