1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. TNF-β
  6. Animal-Free TNF beta Protein, Mouse (His)

Animal-Free TNF beta Protein, Mouse (His)

Cat. No.: HY-P700228AF
SDS COA Handling Instructions

The animal-free TNF beta protein acts as a homotrimeric cytokine that binds TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM.Animal-Free TNF beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNF beta protein, expressed by E.coli , with N-His labeled tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The animal-free TNF beta protein acts as a homotrimeric cytokine that binds TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM.Animal-Free TNF beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNF beta protein, expressed by E.coli , with N-His labeled tag.

Background

The TNF beta Protein, in its homotrimeric form, functions by binding to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM, displaying a high degree of similarity in its interactions. In its heterotrimeric form, formed with LTB, it binds to TNFRSF3/LTBR, revealing its versatility in receptor interactions. Produced by lymphocytes, lymphotoxin, the heterotrimeric form of TNF beta, demonstrates cytotoxicity against a broad spectrum of tumor cells both in vitro and in vivo. It exists as homotrimeric and heterotrimeric complexes, with the latter composed of either two LTB and one LTA subunits or, to a lesser extent, two LTA and one LTB subunits. Notably, TNF beta interacts with TNFRSF14, further contributing to its diverse immunomodulatory functions.

Biological Activity

The ED50 is <30 ng/mL as measure by its ability to induce cytotoxicity in L929 cells in the presence of vactinomycin D.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P09225 (L34-L202)

Gene ID
Molecular Construction
N-term
His
TNF beta (L34-L202)
Accession # P09225
C-term
Synonyms
TNFSF1B; Lymphotoxin-alpha (LT-α); LTalpha; Ltx; TNF-be; TNFSF1; Tnf; Tnfb; Tnfsf; Tnfsf1b; Tnlg1e; hlb38; hlb382; lymph
AA Sequence

LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL

Molecular Weight

Approximately 19.36 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free TNF beta Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free TNF beta Protein, Mouse (His)
Cat. No.:
HY-P700228AF
Quantity:
MCE Japan Authorized Agent: