1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Animal-free Recombinant Proteins
  3. TNF Superfamily Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Receptor Superfamily
  5. TWEAK R/CD266
  6. Animal-Free TNFRSF12A Protein, Mouse (His)

TNFRSF12A Protein, a receptor for TNFSF12/TWEAK, exhibits a weak apoptosis-inducing ability in specific cells.It promotes angiogenesis and endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins.In functional interactions, TNFRSF12A associates with TRAF1 and TRAF2, possibly with TRAF3, suggesting its involvement in signaling pathways contributing to diverse cellular processes.Animal-Free TNFRSF12A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNFRSF12A protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNFRSF12A Protein, a receptor for TNFSF12/TWEAK, exhibits a weak apoptosis-inducing ability in specific cells.It promotes angiogenesis and endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins.In functional interactions, TNFRSF12A associates with TRAF1 and TRAF2, possibly with TRAF3, suggesting its involvement in signaling pathways contributing to diverse cellular processes.Animal-Free TNFRSF12A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNFRSF12A protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Background

The TNFRSF12A protein acts as a receptor for TNFSF12/TWEAK, with a weak ability to induce apoptosis in certain cell types. Additionally, it plays a role in promoting angiogenesis and stimulating the proliferation of endothelial cells. TNFRSF12A may also modulate cellular adhesion to matrix proteins. In its functional interactions, TNFRSF12A associates with TRAF1 and TRAF2, and possibly with TRAF3, indicating its involvement in signaling pathways that contribute to various cellular processes.

Biological Activity

Measure by its ability to induce proliferation in HUVEC cells. The ED50for this effect is <0.2 μg/mL.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

Q9CR75 (S94-H249)

Gene ID
Molecular Construction
N-term
TNFRSF12A (S94-H249)
Accession # Q9CR75
His
C-term
Synonyms
TNFRSF12A; Fibroblast growth factor-inducible immediate-early response protein 14; FN14; CD266 antigen and tweak-receptor
AA Sequence

MSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Molecular Weight

Approximately 18.14 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing in 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free TNFRSF12A Protein, Mouse (His)
Cat. No.:
HY-P700229AF
Quantity:
MCE Japan Authorized Agent: