1. Recombinant Proteins
  2. Others
  3. ANO1/Anoctamin-1 Protein, Human (N-His, C-Myc)

ANO1/Anoctamin-1 Protein, Human (N-His, C-Myc)

Cat. No.: HY-P700616
Handling Instructions Technical Support

ANO1/Anoctamin-1 protein, a calcium-activated chloride channel (CaCC), is involved in ion transport, smooth muscle contraction, and mucus secretion. ANO1/Anoctamin-1 Protein, Human (N-His, C-Myc) is the recombinant human-derived ANO1/Anoctamin-1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ANO1/Anoctamin-1 protein, a calcium-activated chloride channel (CaCC), is involved in ion transport, smooth muscle contraction, and mucus secretion. ANO1/Anoctamin-1 Protein, Human (N-His, C-Myc) is the recombinant human-derived ANO1/Anoctamin-1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Background

ANO1/Anoctamin-1 protein, a calcium-activated chloride channel (CaCC), plays diverse roles in cellular functions. It serves as a major contributor to basal and stimulated chloride conductance in airway epithelial cells, impacting tracheal cartilage development and contributing to airway mucus expression induced by interleukins IL3 and IL8, as well as by the asthma-associated protein CLCA1. ANO1 is indispensable for normal functioning of the interstitial cells of Cajal (ICCs), crucial for electrical pacemaker activity in gastrointestinal smooth muscles, and is involved in transepithelial anion transport and smooth muscle contraction. It is also required for CFTR activation and membrane expression, modulating endoplasmic reticulum Ca(2+) store release. Additionally, ANO1 participates in calcium-activated chloride secretion in human sweat gland epithelial cells, showing increased basal chloride permeability and decreased Ca(2+)-induced chloride permeability. In sensory neurons, ANO1 acts as a heat sensor and modulates spontaneous firing patterns, contributing to calcium-activated chloride channel activity in taste cells and mediating non-histaminergic Mas-related G-protein coupled receptor (MRGPR)-dependent itching in dorsal root ganglion neurons. In the developing brain, ANO1 is essential for the Ca(2+)-dependent process extension of radial glial cells.

Species

Human

Source

E. coli

Tag

C-Myc;N-10*His

Accession

Q5XXA6-1 (S806-A892)

Gene ID
Molecular Construction
N-term
10*His
ANO1 (S806-A892)
Accession # Q5XXA6-1
Myc
C-term
Synonyms
anoctamin 1, calcium activated chloride channel; oral cancer overexpressed 2, ORAOV2, TMEM16A, transmembrane protein 16A; anoctamin-1; DOG1; FLJ10261; TAOS2; oral cancer overexpressed 2; tumor-amplified and overexpressed sequence 2; discovered on gastrointestinal stromal tumors protein 1; transmembrane protein 16A (eight membrane-spanning domains); ORAOV2; TMEM16A
AA Sequence

SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA

Molecular Weight

Approximately 17.6 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ANO1/Anoctamin-1 Protein, Human (N-His, C-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANO1/Anoctamin-1 Protein, Human (N-His, C-Myc)
Cat. No.:
HY-P700616
Quantity:
MCE Japan Authorized Agent: