APLN/Apelin Protein, Human (HEK293, Fc)

APLN protein is an endogenous ligand for the apelin receptor (APLNR), drives receptor internalization, and dissociates more strongly from APLNR than (pyroglu)apelin-13. APLN/Apelin Protein, Human (HEK293, Fc) is the recombinant human-derived APLN protein, expressed by HEK293 , with C-hFc labeled tag.

APLN Protein emerges as the endogenous ligand for the apelin receptor (APLNR), actively participating in the internalization of the receptor. Notably, APLN exhibits differential dissociation characteristics, with apelin-36 dissociating more robustly than (pyroglu)apelin-13 from APLNR. Beyond its role as a ligand, APLN serves diverse physiological functions, influencing cardiac precursor cell movements during gastrulation and heart morphogenesis. Additionally, it has an inhibitory effect on cytokine production in response to T-cell receptor/CD3 cross-linking, suggesting a potential role in modulating immune responses, particularly in neonates through oral intake in colostrum and milk. APLN also contributes to early coronary blood vessel formation and mediates myocardial contractility in an ERK1/2-dependent manner. Furthermore, it may play a role in the central control of body fluid homeostasis by influencing vasopressin release and drinking behavior. In the context of microbial infection, APLN acts as an endogenous ligand for APLNR, serving as an alternative coreceptor with CD4 for HIV-1 infection and exhibiting inhibitory activity on HIV entry in cells coexpressing CD4 and APLNR, with apelin-36 demonstrating greater inhibitory efficacy than other synthetic apelin derivatives.

Immobilized Human APLN, hFc Tag at 0.5 μg/mL (100 μl/Well) on the plate. Dose response curve for Biotinylated Anti-APLN Antibody, hFc Tag with the EC₅₀ of 22.2 ng/mL determined by ELISA.

Human

HEK293

C-hFc

Q9ULZ1 (G23-F77)

8862  [NCBI]

GSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

32-40 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, 200mM Arginine (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.