Apolipoprotein B-100/APOB Protein, Human (His)

Apolipoprotein B-100 (APOB) is a key component of chylomicrons, LDL and VLDL. It acts as a recognition signal to promote cellular binding and internalization of LDL through apoB/E receptors. Apolipoprotein B-100/APOB Protein, Human (His) is the recombinant human-derived Apolipoprotein B-100/APOB protein, expressed by E. coli , with N-6*His labeled tag. The total length of Apolipoprotein B-100/APOB Protein, Human (His) is 100 a.a., with molecular weight of ~16.0 kDa.

Apolipoprotein B-100 (APOB) serves as a crucial protein component found in chylomicrons (apo B-48), LDL (apo B-100), and VLDL (apo B-100). APOB-100 plays a pivotal role as a recognition signal, facilitating the cellular binding and internalization of LDL particles through the apoB/E receptor. This protein interacts with various partners, including PCSK9, MTTP, AUP1, and CIDEB, contributing to diverse physiological processes. The interaction with PCSK9, for instance, has implications in lipid metabolism. Furthermore, the associations with MTTP, AUP1, and CIDEB suggest APOB's involvement in lipid transport, metabolism, and potentially other cellular functions.

Human

E. coli

N-6*His

P04114 (E28-S127)

338  [NCBI]

HHHHHHEEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Approximately 16.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 250 mMNacl, 10% Glycerol, 2 mMEDTA, pH 8.0.

<1 EU/μg, determined by LAL method

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.