1. Recombinant Proteins
  2. Others
  3. Apolipoprotein B-100/APOB Protein, Human (His)

Apolipoprotein B-100/APOB Protein, Human (His)

Cat. No.: HY-P7524A
Handling Instructions Technical Support

Apolipoprotein B-100 (APOB) is a key component of chylomicrons, LDL and VLDL. It acts as a recognition signal to promote cellular binding and internalization of LDL through apoB/E receptors. Apolipoprotein B-100/APOB Protein, Human (His) is the recombinant human-derived Apolipoprotein B-100/APOB protein, expressed by E. coli , with N-6*His labeled tag. The total length of Apolipoprotein B-100/APOB Protein, Human (His) is 100 a.a., with molecular weight of ~16.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Apolipoprotein B-100 (APOB) is a key component of chylomicrons, LDL and VLDL. It acts as a recognition signal to promote cellular binding and internalization of LDL through apoB/E receptors. Apolipoprotein B-100/APOB Protein, Human (His) is the recombinant human-derived Apolipoprotein B-100/APOB protein, expressed by E. coli , with N-6*His labeled tag. The total length of Apolipoprotein B-100/APOB Protein, Human (His) is 100 a.a., with molecular weight of ~16.0 kDa.

Background

Apolipoprotein B-100 (APOB) serves as a crucial protein component found in chylomicrons (apo B-48), LDL (apo B-100), and VLDL (apo B-100). APOB-100 plays a pivotal role as a recognition signal, facilitating the cellular binding and internalization of LDL particles through the apoB/E receptor. This protein interacts with various partners, including PCSK9, MTTP, AUP1, and CIDEB, contributing to diverse physiological processes. The interaction with PCSK9, for instance, has implications in lipid metabolism. Furthermore, the associations with MTTP, AUP1, and CIDEB suggest APOB's involvement in lipid transport, metabolism, and potentially other cellular functions.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P04114 (E28-S127)

Gene ID

338  [NCBI]

Molecular Construction
N-term
6*His
APOB (E28-S127)
Accession # P04114
C-term
Synonyms
APOB; ApolipoproteinB-100
AA Sequence

HHHHHHEEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 250 mM Nacl, 10% Glycerol, 2 mM EDTA, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Apolipoprotein B-100/APOB Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein B-100/APOB Protein, Human (His)
Cat. No.:
HY-P7524A
Quantity:
MCE Japan Authorized Agent: