Apolipoprotein B-100/APOB Protein, Human (His)

Apolipoprotein B-100 (APOB) is a key component of chylomicrons, LDL and VLDL. It acts as a recognition signal to promote cellular binding and internalization of LDL through apoB/E receptors. Apolipoprotein B-100/APOB Protein, Human (His) is the recombinant human-derived Apolipoprotein B-100/APOB protein, expressed by E. coli , with N-6*His labeled tag. The total length of Apolipoprotein B-100/APOB Protein, Human (His) is 100 a.a., with molecular weight of ~16.0 kDa.

Apolipoprotein B-100 (APOB) serves as a crucial protein component found in chylomicrons (apo B-48), LDL (apo B-100), and VLDL (apo B-100). APOB-100 plays a pivotal role as a recognition signal, facilitating the cellular binding and internalization of LDL particles through the apoB/E receptor. This protein interacts with various partners, including PCSK9, MTTP, AUP1, and CIDEB, contributing to diverse physiological processes. The interaction with PCSK9, for instance, has implications in lipid metabolism. Furthermore, the associations with MTTP, AUP1, and CIDEB suggest APOB's involvement in lipid transport, metabolism, and potentially other cellular functions.

Human

E. coli

N-6*His

P04114 (E28-S127)

338  [NCBI]

HHHHHHEEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Approximately 16.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 250 mM Nacl, 10% Glycerol, 2 mM EDTA, pH 8.0.

<1 EU/μg, determined by LAL method

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.