Apolipoprotein E/APOE Protein, Rabbit (His-SUMO)

Apolipoprotein E/APOE is essential for lipid transport between organs and is a key component of lipoproteins such as chylomicrons and high-density lipoprotein. It binds to cell receptors such as LDLR and VLDLR to promote lipoprotein uptake, and has heparin-binding activity to interact with cell surface proteoglycans. Apolipoprotein E/APOE Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived Apolipoprotein E/APOE protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag. The total length of Apolipoprotein E/APOE Protein, Rabbit (His-SUMO) is 292 a.a., with molecular weight of ~53.6 kDa.

APOE is a protein that plays a crucial role in the transport of lipids between organs through plasma and interstitial fluids. It is a key component of various lipoproteins, including chylomicrons, VLDL, IDL, and HDL. APOE binds to a wide range of cellular receptors, such as LDLR and VLDLR, facilitating the uptake of lipoprotein particles. Additionally, APOE has a heparin-binding activity and interacts with heparan-sulfate proteoglycans on cell surfaces, supporting the capture and uptake of lipoproteins. It forms a homotetramer and can interact with ABCA1 in the formation of HDLs. APOE may also interact with other proteins like APP/A4 amyloid-beta peptide, MAPT, MAP2, secreted SORL1, and PMEL for various physiological processes.

Rabbit

E. coli

N-10*His;N-SUMO

P18287 (T20-Q311)

100009337  [NCBI]

TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

Approximately 53.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.