APT-1/LYPLA1 Protein, Human (His)

APT-1/LYPLA1 protein, an acyl-protein thioesterase, hydrolyzes fatty acids from S-acylated cysteine residues in proteins, including G alpha proteins and HRAS. It also depalmitoylates KCNMA1 and potentially ADRB2, while functioning as a lysophospholipase, hydrolyzing lysophosphatidylcholine (lyso-PC) and other lysophospholipids (lyso-PE, lyso-PI, lyso-PS). APT-1/LYPLA1 significantly influences blood coagulation by cleaving plasma phospholipids, generating lysophospholipids for ENPP2, leading to lysophosphatidic acid (LPA) production. APT-1/LYPLA1 Protein, Human (His) is the recombinant human-derived APT-1/LYPLA1 protein, expressed by E. coli, with N-6*His labeled tag. The total length of APT-1/LYPLA1 Protein, Human (His) is 230 a.a., with molecular weight of ~25.0 kDa.

APT-1/LYPLA1 protein functions as an acyl-protein thioesterase, catalyzing the hydrolysis of fatty acids from S-acylated cysteine residues within proteins, including trimeric G alpha proteins and HRAS. Additionally, it exhibits depalmitoylating activity towards KCNMA1 and potentially ADRB2. Acting as a lysophospholipase, APT-1/LYPLA1 hydrolyzes lysophosphatidylcholine (lyso-PC) and other lysophospholipids such as lyso-PE, lyso-PI, and lyso-PS, with a higher affinity for thioesterase activity. This protein significantly contributes to blood coagulation by recognizing and cleaving plasma phospholipids, generating lysophospholipids that serve as substrates for ENPP2, ultimately producing lysophosphatidic acid (LPA).

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

O75608 (M1-D230)

10434  [NCBI]

MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPIDHHHHHH

Approximately 25.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 100 mM NaCl, 1 Mm DTT, 10% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.