AQP1 Protein, Human (His-SUMO)

The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (His-SUMO) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of AQP1 Protein, Human (His-SUMO) is 50 a.a., with molecular weight of ~21.6 kDa.

AQP1, a water-specific channel, plays a pivotal role in enhancing the permeability of plasma membranes in red blood cells and kidney proximal tubules, allowing water movement along osmotic gradients. It forms homotetramers and is a key component of the ankyrin-1 complex, a multiprotein assembly crucial for maintaining the stability and shape of erythrocyte membranes. In the erythrocyte, the ankyrin-1 complex consists of AQP1 along with ANK1, RHCE, RHAG, SLC4A1, EPB42, GYPA, and GYPB. AQP1's functional versatility is further highlighted by its interaction with EPHB2, contributing to endolymph production in the inner ear. Additionally, AQP1 participates in complexes involving STOM. The protein establishes interactions both via its N-terminal region with ANK1 and via its C-terminal region with EPB42, emphasizing its engagement in various cellular processes and protein assemblies.

Human

E. coli

N-6*His;N-SUMO

P29972 (G220-K269)

358  [NCBI]

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Approximately 21.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.