AQP4 Protein, Human (His-SUMO)

The AQP4 protein forms water-specific channels and is involved in brain water balance and solute transport. AQP4 Protein, Human (His-SUMO) is the recombinant human-derived AQP4 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

AQP4, a water-specific channel, is instrumental in maintaining brain water homeostasis and facilitating glymphatic solute transport. It plays a crucial role in regulating the exchange of water across the blood-brain interface, influencing cerebrospinal fluid influx into the brain cortex and parenchyma through paravascular spaces surrounding penetrating arteries. Additionally, AQP4 is essential for the proper drainage of interstitial fluid along paravenous pathways, contributing to the normal clearance of solutes, including soluble beta-amyloid peptides derived from APP, from the brain interstitial fluid. While redundant in urinary water homeostasis and concentrating ability, AQP4 forms homotetramers, with the tetramers capable of organizing into oligomeric arrays of varying sizes in membranes. This oligomerization can facilitate cell-cell adhesion through interactions between AQP4 arrays in adjacent cells. AQP4 is also part of a complex involving MLC1, TRPV4, HEPACAM, and ATP1B1, highlighting its role within a larger molecular network.

Human

E. coli

N-6*His;N-SUMO

P55087 (C253-V323)

361  [NCBI]

CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Approximately 27 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.