1. Recombinant Proteins
  2. Others
  3. ARF1 Protein, Human (His-GST, Myc)

ARF1 is a small GTPase responsible for coordinating protein transport within the Golgi complex. In its GTP-bound state, ARF1 critically regulates Golgi vesicle budding and uncoating by recruiting coat proteins. ARF1 Protein, Human (His-GST, Myc) is the recombinant human-derived ARF1 protein, expressed by E. coli , with N-10*His, C-Myc, GST labeled tag. The total length of ARF1 Protein, Human (His-GST, Myc) is 180 a.a., with molecular weight of ~55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ARF1 is a small GTPase responsible for coordinating protein transport within the Golgi complex. In its GTP-bound state, ARF1 critically regulates Golgi vesicle budding and uncoating by recruiting coat proteins. ARF1 Protein, Human (His-GST, Myc) is the recombinant human-derived ARF1 protein, expressed by E. coli , with N-10*His, C-Myc, GST labeled tag. The total length of ARF1 Protein, Human (His-GST, Myc) is 180 a.a., with molecular weight of ~55 kDa.

Background

ARF1, a small GTPase, intricately participates in protein trafficking among distinct cellular compartments, notably within the Golgi complex. In its GTP-bound state, ARF1 plays a pivotal role in modulating vesicle budding and uncoating processes within the Golgi, orchestrating the recruitment of coatomer proteins to the Golgi membrane. The subsequent hydrolysis of ARF1-bound GTP, facilitated by ARFGAPs proteins, becomes essential for the dissociation of coat proteins from Golgi membranes and vesicles. Additionally, the GTP-bound form of ARF1 interacts with PICK1, regulating AMPA receptor (AMPAR) trafficking and influencing synaptic plasticity of excitatory synapses, as well as spine shrinkage during long-term depression (LTD). In the context of microbial infection, ARF1 takes on an unexpected role as an allosteric activator of the cholera toxin catalytic subunit, functioning in ADP-ribosyltransferase activity.

Species

Human

Source

E. coli

Tag

N-10*His;C-Myc;N-GST

Accession

P84077 (G2-K181)

Gene ID

375  [NCBI]

Molecular Construction
N-term
10*His-GST
ARF1 (G2-K181)
Accession # P84077
Myc
C-term
Synonyms
ADP Ribosylation Factor 1; ADP-ribosylation factor 1; ARF 1; ARF1; ARF1_HUMAN
AA Sequence

GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

Molecular Weight

Approximately 55 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ARF1 Protein, Human (His-GST, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ARF1 Protein, Human (His-GST, Myc)
Cat. No.:
HY-P72089
Quantity:
MCE Japan Authorized Agent: