1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Arginase-1/ARG1 Protein, Mouse (P.pastoris, His)

Arginase-1/ARG1 Protein, Mouse (P.pastoris, His)

Cat. No.: HY-P71833
SDS COA Handling Instructions Technical Support

Arginase-1 (ARG1) plays a key role in the urea cycle, converting L-arginine into urea and L-ornithine. This cycle maintains L-arginine homeostasis, which is critical for nitric oxide synthase to compete for arginine. Arginase-1/ARG1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Arginase-1/ARG1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Arginase-1/ARG1 Protein, Mouse (P.pastoris, His) is 323 a.a., with molecular weight of ~36.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Arginase-1/ARG1 Protein, Mouse (P.pastoris, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Arginase-1 (ARG1) plays a key role in the urea cycle, converting L-arginine into urea and L-ornithine. This cycle maintains L-arginine homeostasis, which is critical for nitric oxide synthase to compete for arginine. Arginase-1/ARG1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Arginase-1/ARG1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Arginase-1/ARG1 Protein, Mouse (P.pastoris, His) is 323 a.a., with molecular weight of ~36.8 kDa.

Background

Arginase-1 (ARG1) stands as a central component of the urea cycle, crucial for the conversion of L-arginine to urea and L-ornithine, the latter serving as a precursor for metabolites vital in collagen synthesis and bioenergetic pathways that fuel cell proliferation. Primarily active in the liver and, to a lesser extent, in the kidneys, the urea cycle plays a pivotal role in maintaining L-arginine homeostasis, particularly in tissues where nitric oxide synthase (NOS) and arginase engage in a competitive relationship for intracellular arginine. Beyond its metabolic functions, ARG1 emerges as a critical regulator of innate and adaptive immune responses, participating in antimicrobial effector pathways in polymorphonuclear granulocytes (PMN). Upon PMN cell death, ARG1 is released, depleting arginine in the microenvironment and dampening T cell and natural killer (NK) cell proliferation as well as cytokine secretion. Notably, in group 2 innate lymphoid cells (ILC2s), ARG1 contributes to acute type 2 inflammation in the lung, influencing optimal ILC2 proliferation. Moreover, ARG1 plays a multifaceted role in the immune responses of alternatively activated or M2 macrophages, impacting processes such as wound healing, tissue regeneration, defense against multicellular pathogens, and immune suppression with outcomes varying by organ. In tumor-infiltrating dendritic cells (DCs) and myeloid-derived suppressor cells (MDSCs), ARG1 contributes to the suppression of T cell-mediated antitumor immunity, highlighting its diverse and context-dependent immunoregulatory functions.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

Q61176 (M1-K323)

Gene ID
Molecular Construction
N-term
6*His
ARGI1 (M1-K323)
Accession # Q61176
C-term
Synonyms
Arg1Arginase-1; EC 3.5.3.1; Liver-type arginase; Type I arginase
AA Sequence

MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK

Molecular Weight

Approximately 36.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Arginase-1/ARG1 Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Arginase-1/ARG1 Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71833
Quantity:
MCE Japan Authorized Agent: