Arginase-2/ARG2 Protein, Human (His)

Arginase-2/ARG2 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Arginase-2 (Arg2) acts as a fasting-induced hepatocyte factor that protects against hepatic and peripheral fat accumulation, hepatic inflammatory responses, and insulin and glucose intolerance in obese murine models^[1].

Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (Arginase-1, Arginase-2) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. Arginase-2 is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney^[1].

Measured by the production of urea during the hydrolysis of arginine. The specific activity is 538330.64 pmol/min/µg, as measured under the described conditions.

Human

E. coli

N-6*His

P78540 (H24-G330)

384  [NCBI]

HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHHHHHH

Approximately 33.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 150 mM NaCl, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Yiming Zhang, et al. Hepatic arginase 2 (Arg2) is sufficient to convey the therapeutic metabolic effects of fasting. Nat Commun. 2019 Apr 8;10(1):1587.  [Content Brief]