ART4/CD297 Protein, Rat (HEK293, His)

ART4/CD297 is a predicted NAD+ ADP-ribosyltransferase that exhibits biased expression in tissues such as the adrenal gland and thymus. As an ortholog of human ART4, it is involved in peptidyl arginine ADP ribosylation. ART4/CD297 Protein, Rat (HEK293, His) is the recombinant rat-derived ART4/CD297 protein, expressed by HEK293 , with C-His labeled tag.

ART4/CD297, a predicted NAD+ ADP-ribosyltransferase, is implicated in peptidyl-arginine ADP-ribosylation. As an ortholog to human ART4 (ADP-ribosyltransferase 4 (inactive) (Dombrock blood group)), this protein exhibits biased expression in tissues such as the adrenal gland, thymus, and six other tissues. The prediction of NAD+ ADP-ribosyltransferase activity underscores its potential role in post-translational modification processes, particularly in the context of peptidyl-arginine ADP-ribosylation, contributing to the functional diversity of this enzyme.

Rat

HEK293

C-6*His

F1MA10/NP_001166980 (G30-K269)

312806  [NCBI]

GSAEAALKVDVDLTPGSFDDQYRGCSKQVLEELNQGDYFVREIDTHKYYSRAWQKAHLTWLNQATSLPESMTPVHAVAILVFTLNLNVSSDFAKAMTRASGSPGQYRQSFHFKYLHYYLTSAIQLLRKESSTKNGSPCYRVHHRMKDVNIEANVGSTVRFGQFLSASLLKEETQVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKNCSLKGDLINLRSAGNVSRYNCQLLK

Approximately 38-48 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.