1. Recombinant Proteins
  2. Receptor Proteins
  3. ASGR1/ASGPR1 Protein, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag. The total length of ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is 225 a.a., with molecular weight of 30-45 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag. The total length of ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is 225 a.a., with molecular weight of 30-45 kDa.

Background

ASGR1/ASGPR1 Protein assumes a crucial role in cellular processes by mediating the endocytosis of plasma glycoproteins whose terminal sialic acid residue on complex carbohydrate moieties has been removed. The receptor's recognition of terminal galactose and N-acetylgalactosamine units enables the internalization of ligands, forming a complex that is subsequently transported to a sorting organelle. Within this organelle, the receptor and ligand disassociate, and ASGR1/ASGPR1 is recycled back to the cell membrane surface. The protein's involvement in these dynamic processes underscores its significance in the cellular handling of glycoproteins and contributes to the regulation of cellular homeostasis. Notably, ASGR1/ASGPR1 also interacts with LASS2, expanding its molecular associations and suggesting potential implications in cellular signaling or coordination.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized ASGR1 at 2.5 μg/mL (100 μL/well) can bind Biotinylated Von Willebrand Factor. The ED50 for this effect is 0.8278 μg/mL, corresponding to a specific activity is 1.21×103 Unit/mg.

  • Measured by its binding ability in a functional ELISA. Immobilized ASGR1 at 2.5 μg/mL (100 μL/well) can bind Biotinylated Von Willebrand Factor. The ED50 for this effect is 0.8278 μg/mL, corresponding to a specific activity is 1.21×103 Unit/mg.
Species

Mouse

Source

HEK293

Tag

N-His

Accession

P34927 (S60-N284)

Gene ID
Molecular Construction
N-term
His
ASGR1 (S60-N284)
Accession # P34927
C-term
Synonyms
ASGPR; ASGPR1; ASGR1; Asialoglycoprotein receptor 1; CLEC4H1; Hepatic lectin H1; MHL1
AA Sequence

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Weight

30-45 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ASGR1/ASGPR1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ASGR1/ASGPR1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75498
Quantity:
MCE Japan Authorized Agent: