ASGR1/ASGPR1 Protein, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag. The total length of ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is 225 a.a., with molecular weight of 30-45 kDa.

ASGR1/ASGPR1 Protein assumes a crucial role in cellular processes by mediating the endocytosis of plasma glycoproteins whose terminal sialic acid residue on complex carbohydrate moieties has been removed. The receptor's recognition of terminal galactose and N-acetylgalactosamine units enables the internalization of ligands, forming a complex that is subsequently transported to a sorting organelle. Within this organelle, the receptor and ligand disassociate, and ASGR1/ASGPR1 is recycled back to the cell membrane surface. The protein's involvement in these dynamic processes underscores its significance in the cellular handling of glycoproteins and contributes to the regulation of cellular homeostasis. Notably, ASGR1/ASGPR1 also interacts with LASS2, expanding its molecular associations and suggesting potential implications in cellular signaling or coordination.

Measured by its binding ability in a functional ELISA. Immobilized ASGR1 at 2.5 μg/mL (100 μL/well) can bind Biotinylated Von Willebrand Factor. The ED₅₀ for this effect is 0.8278 μg/mL, corresponding to a specific activity is 1.21×10³ Unit/mg.

• 
  Measured by its binding ability in a functional ELISA. Immobilized ASGR1 at 2.5 μg/mL (100 μL/well) can bind Biotinylated Von Willebrand Factor. The ED₅₀ for this effect is 0.8278 μg/mL, corresponding to a specific activity is 1.21×10³ Unit/mg.

Mouse

HEK293

N-His

P34927 (S60-N284)

11889  [NCBI]

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

30-45 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.