1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. ASPH Protein, Human (His-SUMO)

ASPH protein phosphorylates SPRTN, facilitating its chromatin recruitment and decreasing replication stress. ASPH activates the G2/M checkpoint by phosphorylating and inhibiting PABIR1/FAM122A, leading to serine/threonine-protein phosphatase 2A-mediated dephosphorylation and stabilization of WEE1 levels and activity. ASPH Protein, Human (His-SUMO) is the recombinant human-derived ASPH protein, expressed by E. coli, with N-6*His, N-SUMO labeled tag. The total length of ASPH Protein, Human (His-SUMO) is 196 a.a., with molecular weight of ~38.2 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ASPH protein phosphorylates SPRTN, facilitating its chromatin recruitment and decreasing replication stress. ASPH activates the G2/M checkpoint by phosphorylating and inhibiting PABIR1/FAM122A, leading to serine/threonine-protein phosphatase 2A-mediated dephosphorylation and stabilization of WEE1 levels and activity. ASPH Protein, Human (His-SUMO) is the recombinant human-derived ASPH protein, expressed by E. coli, with N-6*His, N-SUMO labeled tag. The total length of ASPH Protein, Human (His-SUMO) is 196 a.a., with molecular weight of ~38.2 kDa.

Background

CDC25 also phosphorylates a protein called SPRTN, promoting its recruitment to chromatin. It reduces replication stress and activates the G2/M checkpoint by phosphorylating and inactivating PABIR1/FAM122A. This promotes the serine/threonine-protein phosphatase 2A-mediated dephosphorylation and stabilization of WEE1 levels and activity.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

Q12797 (F75-T270)

Gene ID

444  [NCBI]

Molecular Construction
N-term
6*His-SUMO
ASPH (F75-T270)
Accession # Q12797
C-term
Synonyms
ASPH; BAHAspartyl/asparaginyl beta-hydroxylase; EC 1.14.11.16; Aspartate beta-hydroxylase; ASP beta-hydroxylase; Peptide-aspartate beta-dioxygenase
AA Sequence

FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT

Molecular Weight

Approximately 38.2 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ASPH Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ASPH Protein, Human (His-SUMO)
Cat. No.:
HY-P72092
Quantity:
MCE Japan Authorized Agent: