1. Recombinant Proteins
  2. Others
  3. ATOX1 Protein, Human (His)

ATOX1 Protein, Human (His)

Cat. No.: HY-P75585
SDS COA Handling Instructions

ATOX1 Protein plays a crucial role in cellular copper transport, binding to and delivering cytosolic copper to copper ATPase proteins. This process is integral to cellular antioxidant defense mechanisms. ATOX1 functions as a homodimer, supported by research findings. It interacts with ATP7B and ATP7A. In its dimer form, ATOX1 interacts with SLC31A1, contributing to its stability and controlling intracellular Cu(I) levels. ATOX1 Protein, Human (His) is the recombinant human-derived ATOX1 protein, expressed by E. coli , with N-His labeled tag. The total length of ATOX1 Protein, Human (His) is 68 a.a., with molecular weight of ~9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $75 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
500 μg $950 In-stock
1 mg $1620 In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ATOX1 Protein plays a crucial role in cellular copper transport, binding to and delivering cytosolic copper to copper ATPase proteins. This process is integral to cellular antioxidant defense mechanisms. ATOX1 functions as a homodimer, supported by research findings. It interacts with ATP7B and ATP7A. In its dimer form, ATOX1 interacts with SLC31A1, contributing to its stability and controlling intracellular Cu(I) levels. ATOX1 Protein, Human (His) is the recombinant human-derived ATOX1 protein, expressed by E. coli , with N-His labeled tag. The total length of ATOX1 Protein, Human (His) is 68 a.a., with molecular weight of ~9 kDa.

Background

The ATOX1 protein serves a crucial role in cellular copper transport by binding to and delivering cytosolic copper to copper ATPase proteins. This process is integral to cellular antioxidant defense mechanisms. ATOX1 functions as a homodimer, as indicated by research findings (source: PubMed:24837030). Additionally, it interacts with ATP7B (source: PubMed:10966647) and ATP7A (sources: PubMed:21667063, PubMed:19453293). The protein, in its dimer form, also interacts with SLC31A1 via its C-terminal domain, contributing to ATOX1 stability and controlling intracellular Cu(I) levels (sources: PubMed:24837030, PubMed:26745413).

Species

Human

Source

E. coli

Tag

N-His

Accession

O00244 (M1-E68)

Gene ID

475  [NCBI]

Molecular Construction
N-term
His
ATOX1 (M1-E68)
Accession # O00244
C-term
Synonyms
Copper transport protein ATOX1; Metal transport protein ATX1; HAH1
AA Sequence

MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

Molecular Weight

Approximately 9 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ATOX1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ATOX1 Protein, Human (His)
Cat. No.:
HY-P75585
Quantity:
MCE Japan Authorized Agent: