1. Recombinant Proteins
  2. Others
  3. ATP1B1 Protein, Mouse (Cell-Free, His)

ATP1B1 Protein, Mouse (Cell-Free, His)

Cat. No.: HY-P702219
SDS COA Handling Instructions

The ATP1B1 protein is a noncatalytic component that forms a heterodimer with the α subunit and catalyzes ATP hydrolysis and Na(+) and K(+) ion exchange across the plasma membrane. These heterodimers critically regulate sodium pumping at the plasma membrane, affecting ion balance. ATP1B1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived ATP1B1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of ATP1B1 Protein, Mouse (Cell-Free, His) is 304 a.a., with predicted molecular weight of 36.7 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ATP1B1 protein is a noncatalytic component that forms a heterodimer with the α subunit and catalyzes ATP hydrolysis and Na(+) and K(+) ion exchange across the plasma membrane. These heterodimers critically regulate sodium pumping at the plasma membrane, affecting ion balance. ATP1B1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived ATP1B1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of ATP1B1 Protein, Mouse (Cell-Free, His) is 304 a.a., with predicted molecular weight of 36.7 kDa.

Background

ATP1B1 Protein serves as the non-catalytic component of the active enzyme responsible for catalyzing the hydrolysis of ATP, coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. As a crucial subunit, ATP1B1, in conjunction with the alpha subunit, forms heterodimers that regulate the quantity of sodium pumps transported to the plasma membrane. Beyond its role in ion transport, ATP1B1 is implicated in essential cellular processes, including cell adhesion and the establishment of epithelial cell polarity. This multifaceted functionality underscores the significance of ATP1B1 in cellular homeostasis, ion balance, and the maintenance of structural integrity within tissues.

Species

Mouse

Source

E. coli Cell-free

Tag

N-10*His

Accession

P14094 (M1-S304)

Gene ID

11931

Molecular Construction
N-term
10*His
ATP1B1 (M1-S304)
Accession # P14094
C-term
Synonyms
Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1
AA Sequence

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS

Molecular Weight

Monomer: 35 kDa Dimer: 70 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij-78, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ATP1B1 Protein, Mouse (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ATP1B1 Protein, Mouse (Cell-Free, His)
Cat. No.:
HY-P702219
Quantity:
MCE Japan Authorized Agent: