ATP6AP2 Protein, Human (His)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ATP6AP2 Protein, Human (His) is 334 a.a., with molecular weight of ~40 kDa.

The ATP6AP2 protein, a multifunctional player in cellular processes, serves as a renin and prorenin cellular receptor while contributing to the assembly of the lysosomal proton-transporting V-type ATPase (V-ATPase) and acidification of the endo-lysosomal system. It is implicated in renin-dependent cellular responses, activating ERK1 and ERK2, and plays a potential role in the renin-angiotensin system (RAS) by enhancing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I. Its involvement in V-ATPase assembly and lysosomal acidification regulates protein degradation, influencing signaling pathways crucial for proper brain development, synapse morphology, and synaptic transmission. ATP6AP2 interacts with renin and functions as an accessory component of the V-ATPase protein pump. Its interactions with ATP6AP1, ATP6V0D1, TMEM9, and VMA21 further underscore its intricate role in the assembly and regulation of the V-ATPase complex. This multifaceted functionality positions ATP6AP2 as a key orchestrator in various cellular pathways.

Human

E. coli

N-6*His

O75787 (N17-D350)

10159  [NCBI]

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Approximately 40 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of Tris-based buffer, 50% Glycerol or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.