ATP6V1F Protein, Human

ATP6V1F is an important subunit of the vacuolar (H+)-ATPase (V-ATPase) V1 complex and is an important component of this enzyme's role in cellular pH regulation. It forms a catalytic AB heterodimer and peripheral stem that plays a role in ATP hydrolysis. ATP6V1F Protein, Human is the recombinant human-derived ATP6V1F protein, expressed by E. coli , with tag free. The total length of ATP6V1F Protein, Human is 119 a.a., with molecular weight of ~13 KDa.

ATP6V1F, a vital subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), constitutes part of the multisubunit enzyme that plays a central role in cellular pH regulation. This enzyme is a heteromultimeric assembly comprising two essential complexes: the ATP-hydrolytic V1 complex and the proton translocation V0 complex. Within the V1 complex, ATP6V1F contributes to the formation of the catalytic AB heterodimers, constituting a heterohexamer, and the peripheral stalks comprised of EG heterodimers. Additionally, it is an integral part of the central rotor, working in concert with subunit D. The V1 complex is responsible for ATP hydrolysis, whereas the V0 complex, in which ATP6V1F is not directly mentioned but is implied, is crucial for proton translocation across membranes. This proton transport involves various subunits, including the proton transport subunit a, a ring of proteolipid subunits c9c'', rotary subunit d, subunits e and f, and accessory subunits ATP6AP1/Ac45 and ATP6AP2/PRR. The cooperative action of these subunits underscores the significance of ATP6V1F in the intricate machinery of V-ATPase, which acidifies and maintains pH in cellular compartments and, in certain cell types, at the plasma membrane, thereby influencing various physiological processes.

Measured by its binding ability in a functional ELISA. When Recombinant Human ATP6V1F is present at 2 μg/mL, can bind ATP6V1F antibody. The ED₅₀ for this effect is 195 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human ATP6V1F is present at 2 μg/mL, can bind ATP6V1F antibody.The ED₅₀ for this effect is 195 ng/mL.

Human

E. coli

Tag Free

Q16864 ( M1-R119 )

9296

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR

Approximately 13 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.