AXL Protein, Mouse (HEK293, His-Fc)

The AXL protein has predicted roles in various cellular functions, binds to phosphatidylinositol 3-kinase and phosphatidylserine, and serves as a viral receptor. It negatively regulates apoptosis and positively regulates protein kinase B signaling. AXL Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived AXL protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

AXL protein is predicted to play a crucial role in various cellular functions, including phosphatidylinositol 3-kinase binding activity, phosphatidylserine binding activity, and virus receptor activity. Involved in negative regulation of apoptotic processes and positive regulation of protein kinase B signaling, AXL acts upstream of diverse processes such as animal organ development, myeloid cell homeostasis, and negative regulation of tumor necrosis factor production. Predicted to be located in cellular components like the actin cytoskeleton, cell surface, and host cell surface, AXL is expected to be an integral component of the plasma membrane and part of a receptor complex. With broad expression observed in various structures such as the alimentary system, brain, genitourinary system, respiratory system, and visual system, AXL likely plays a crucial role in numerous physiological processes across different tissues.

Immobilized AXL at 2 μg/mL (100 μL/well) can bind Biotinylated GAS6 protein. The ED₅₀ for this effect is 9.284 ng/mL, corresponding to a specific activity is 1.08×10^5 Unit/mg.

• 
  Immobilized AXL at 2 μg/mL (100 μL/well) can bind Biotinylated GAS6 protein. The ED₅₀ for this effect is 9.284 ng/mL, corresponding to a specific activity is 1.08×10⁵Unit/mg.

Mouse

HEK293

C-hFc;C-His

NP_033491.2 (H20-P443)

26362  [NCBI]

HKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWP

95-120 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.