1. Recombinant Proteins
  2. Receptor Proteins Enzymes & Regulators
  3. Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. TAM Receptor
  5. Axl Proteins Axl Proteins
  6. AXL Protein, Mouse (HEK293, His-Fc)

The AXL protein has predicted roles in various cellular functions, binds to phosphatidylinositol 3-kinase and phosphatidylserine, and serves as a viral receptor. It negatively regulates apoptosis and positively regulates protein kinase B signaling. AXL Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived AXL protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The AXL protein has predicted roles in various cellular functions, binds to phosphatidylinositol 3-kinase and phosphatidylserine, and serves as a viral receptor. It negatively regulates apoptosis and positively regulates protein kinase B signaling. AXL Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived AXL protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Background

AXL protein is predicted to play a crucial role in various cellular functions, including phosphatidylinositol 3-kinase binding activity, phosphatidylserine binding activity, and virus receptor activity. Involved in negative regulation of apoptotic processes and positive regulation of protein kinase B signaling, AXL acts upstream of diverse processes such as animal organ development, myeloid cell homeostasis, and negative regulation of tumor necrosis factor production. Predicted to be located in cellular components like the actin cytoskeleton, cell surface, and host cell surface, AXL is expected to be an integral component of the plasma membrane and part of a receptor complex. With broad expression observed in various structures such as the alimentary system, brain, genitourinary system, respiratory system, and visual system, AXL likely plays a crucial role in numerous physiological processes across different tissues.

Biological Activity

Immobilized AXL at 2 μg/mL (100 μL/well) can bind Biotinylated GAS6 protein. The ED50 for this effect is 9.284 ng/mL, corresponding to a specific activity is 1.08×10^5 Unit/mg.

  • Immobilized AXL at 2 μg/mL (100 μL/well) can bind Biotinylated GAS6 protein. The ED50 for this effect is 9.284 ng/mL, corresponding to a specific activity is 1.08×105Unit/mg.
Species

Mouse

Source

HEK293

Tag

C-hFc;C-His

Accession

NP_033491.2 (H20-P443)

Gene ID
Molecular Construction
N-term
AXL (H20-P443)
Accession # NP_033491.2
hFc-His
C-term
Synonyms
Tyrosine-protein kinase receptor UFO; AXL oncogene; UFO
AA Sequence

HKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWP

Molecular Weight

95-120 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AXL Protein, Mouse (HEK293, His-Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AXL Protein, Mouse (HEK293, His-Fc)
Cat. No.:
HY-P74406
Quantity:
MCE Japan Authorized Agent: