Azurocidin Protein, Human (HEK293, His)

Azurocidin Protein, Human (HEK293, His), a recombinant human Azurocidin produced in HEK293 cells, has a His tag. Azurocidin is a protein that is mobilized rapidly from emigrating polymorphonuclear leukocytes (PMN). Azurocidin serves as an important mediator during the initiation of the immune response^[1].

Azurocidin, released from PMN secretory vesicles or primary granules, acts as a chemoattractant and activator of monocyte and macrophages. The functional consequence is enhancement of cytokine release and bacterial phagocytosis, allowing for a more efficient bacterial clearance. Leukocyte activation by Azurocidin is mediated via β2-integrins, and Azurocidin-induced chemotaxis is dependent on formyl-peptide receptors. In addition, Azurocidin activates endothelial cells leading to vascular leakage and edema formation. For these reasons, targeting azurocidin release and its actions may have therapeutic potential in inflammatory disease conditions^[1].

Measured by its ability to enhance LPS-induced TNF-alpha secretion from THP-1 cells. The ED₅₀ for this effect is ≤1.315 μg/mL in the presence of 2 μg/mL LPS.

• 
  Measured by its ability to enhance LPS-induced TNF-alpha secretion from THP-1 cells. The ED₅₀ for this effect is 1.061 μg/mL in the presence of 2 μg/mL LPS, corresponding to a specific activity is 942.507 U/mg.

Human

HEK293

C-6*His

P20160 (I27-P250)

566  [NCBI]

IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGP

Approximately 35-44 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 20 mM HEPES, 150 mM NaCl, pH 7.5 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Oliver Soehnlein, et al. Neutrophil-derived azurocidin alarms the immune system. J Leukoc Biol. 2009 Mar;85(3):344-51.  [Content Brief]