1. Recombinant Proteins
  2. Viral Proteins
  3. B18R Protein, Vaccinia virus (HEK293, His)

B18R protein functions as a potent antagonist against the antiviral effects of host IFN-alpha/beta and key IFN-inducible proteins, such as OAS1 involved in viral RNA degradation. It acts as a soluble IFN-alpha receptor, effectively impeding the interaction between host IFN-alpha and its receptor. The protein's ability to interact with host IFNA1 underscores its role in modulating the host's immune response against viral infections. B18R Protein, Vaccinia virus (HEK293, His) is the recombinant Virus-derived B18R protein, expressed by HEK293 , with C-6*His labeled tag. The total length of B18R Protein, Vaccinia virus (HEK293, His) is 332 a.a., with molecular weight of 46-65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

B18R protein functions as a potent antagonist against the antiviral effects of host IFN-alpha/beta and key IFN-inducible proteins, such as OAS1 involved in viral RNA degradation. It acts as a soluble IFN-alpha receptor, effectively impeding the interaction between host IFN-alpha and its receptor. The protein's ability to interact with host IFNA1 underscores its role in modulating the host's immune response against viral infections. B18R Protein, Vaccinia virus (HEK293, His) is the recombinant Virus-derived B18R protein, expressed by HEK293 , with C-6*His labeled tag. The total length of B18R Protein, Vaccinia virus (HEK293, His) is 332 a.a., with molecular weight of 46-65 kDa.

Background

The B18R protein functions as a potent antagonist against the antiviral effects induced by host IFN-alpha/beta and key IFN-inducible proteins, including the host OAS1 involved in viral RNA degradation. Acting as a soluble IFN-alpha receptor, B18R inhibits the interaction between host IFN-alpha and its receptor. This interference in the IFN-alpha signaling pathway serves to counteract the host's innate immune response against viral infections. Notably, B18R achieves its inhibitory effects by interacting with host IFNA1. The multifaceted actions of B18R underscore its role as a viral immune evasion strategy, highlighting its importance in modulating the host's antiviral defenses.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized IFN-α1a at 2 μg/mL (100 μL/well) can bind Vaccinia virus B18R. The ED50 for this effect is 9.681 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized IFN-α1a at 2 μg/mL (100 μL/well) can bind Vaccinia virus B18R. The ED50 for this effect is 9.681 ng/mL.
Species

Virus

Source

HEK293

Tag

C-6*His

Accession

P25213 (H20-E351)

Gene ID

3707577  [NCBI]

Molecular Construction
N-term
B18R (H20-E351)
Accession # P25213
6*His
C-term
Synonyms
rVaSoluble interferon alpha/beta receptor B18/VACWR200, His; Soluble interferon alpha/beta receptor B18; VACWR200
AA Sequence

HSYAIDIENEITEFFNKMRDTLPAKDSKWLNPACMFGGTMNDIAALGEPFSAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDCVQGIVRSHIRKPPSCIPKTYELGTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIKYSQTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTSLLIDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLYFENVTEEYIGNTYKCRGHNYYFEKTLTTTVVLE

Molecular Weight

46-65 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

B18R Protein, Vaccinia virus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B18R Protein, Vaccinia virus (HEK293, His)
Cat. No.:
HY-P70015
Quantity:
MCE Japan Authorized Agent: