B18R Protein, Vaccinia virus (HEK293, His)

B18R protein functions as a potent antagonist against the antiviral effects of host IFN-alpha/beta and key IFN-inducible proteins, such as OAS1 involved in viral RNA degradation. It acts as a soluble IFN-alpha receptor, effectively impeding the interaction between host IFN-alpha and its receptor. The protein's ability to interact with host IFNA1 underscores its role in modulating the host's immune response against viral infections. B18R Protein, Vaccinia virus (HEK293, His) is the recombinant Virus-derived B18R protein, expressed by HEK293 , with C-6*His labeled tag. The total length of B18R Protein, Vaccinia virus (HEK293, His) is 332 a.a., with molecular weight of 46-65 kDa.

The B18R protein functions as a potent antagonist against the antiviral effects induced by host IFN-alpha/beta and key IFN-inducible proteins, including the host OAS1 involved in viral RNA degradation. Acting as a soluble IFN-alpha receptor, B18R inhibits the interaction between host IFN-alpha and its receptor. This interference in the IFN-alpha signaling pathway serves to counteract the host's innate immune response against viral infections. Notably, B18R achieves its inhibitory effects by interacting with host IFNA1. The multifaceted actions of B18R underscore its role as a viral immune evasion strategy, highlighting its importance in modulating the host's antiviral defenses.

Measured by its binding ability in a functional ELISA. Immobilized IFN-α1a at 2 μg/mL (100 μL/well) can bind Vaccinia virus B18R. The ED₅₀ for this effect is 9.681 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized IFN-α1a at 2 μg/mL (100 μL/well) can bind Vaccinia virus B18R. The ED₅₀ for this effect is 9.681 ng/mL.

Virus

HEK293

C-6*His

P25213 (H20-E351)

3707577  [NCBI]

HSYAIDIENEITEFFNKMRDTLPAKDSKWLNPACMFGGTMNDIAALGEPFSAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDCVQGIVRSHIRKPPSCIPKTYELGTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIKYSQTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTSLLIDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLYFENVTEEYIGNTYKCRGHNYYFEKTLTTTVVLE

46-65 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.