B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His)

Beta-2 microglobulin (B2M) is vital in presenting antigens to the immune system through MHC class I molecules. It forms a heterodimer with an alpha chain to create MHC class I molecules. B2M also forms a heterotrimer with MR1 and a metabolite antigen, enhancing antigen presentation and immune recognition. B2M's molecular interactions facilitate immune system functioning and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His) is the recombinant mouse-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag. The total length of B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His) is 99 a.a., with molecular weight of ~14.5 kDa.

Beta-2 microglobulin (B2M) protein is a crucial component of the class I major histocompatibility complex (MHC), playing a key role in presenting peptide antigens to the immune system. It forms a heterodimer with an alpha chain, together comprising the major histocompatibility complex class I molecules. Additionally, B2M can form a heterotrimer with MR1 and a metabolite antigen, further contributing to antigen presentation and immune recognition processes. By participating in these molecular interactions, B2M helps in the proper functioning of the immune system and the recognition of foreign substances.

Mouse

HEK293

C-His

P01887 (I21-M119)

12010  [NCBI]

IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM

Approximately 14.5 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.