1. Recombinant Proteins
  2. Others
  3. B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His)

B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His)

Cat. No.: HY-P74403
Handling Instructions Technical Support

Beta-2 microglobulin (B2M) is vital in presenting antigens to the immune system through MHC class I molecules. It forms a heterodimer with an alpha chain to create MHC class I molecules. B2M also forms a heterotrimer with MR1 and a metabolite antigen, enhancing antigen presentation and immune recognition. B2M's molecular interactions facilitate immune system functioning and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His) is the recombinant mouse-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag. The total length of B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His) is 99 a.a., with molecular weight of ~14.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Beta-2 microglobulin (B2M) is vital in presenting antigens to the immune system through MHC class I molecules. It forms a heterodimer with an alpha chain to create MHC class I molecules. B2M also forms a heterotrimer with MR1 and a metabolite antigen, enhancing antigen presentation and immune recognition. B2M's molecular interactions facilitate immune system functioning and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His) is the recombinant mouse-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag. The total length of B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His) is 99 a.a., with molecular weight of ~14.5 kDa.

Background

Beta-2 microglobulin (B2M) protein is a crucial component of the class I major histocompatibility complex (MHC), playing a key role in presenting peptide antigens to the immune system. It forms a heterodimer with an alpha chain, together comprising the major histocompatibility complex class I molecules. Additionally, B2M can form a heterotrimer with MR1 and a metabolite antigen, further contributing to antigen presentation and immune recognition processes. By participating in these molecular interactions, B2M helps in the proper functioning of the immune system and the recognition of foreign substances.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P01887 (I21-M119)

Gene ID
Molecular Construction
N-term
B2M (I21-M119)
Accession # P01887
His
C-term
Synonyms
Beta-2-microglobulin; B2M
AA Sequence

IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM

Molecular Weight

Approximately 14.5 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74403
Quantity:
MCE Japan Authorized Agent: