1. Recombinant Proteins
  2. Others
  3. B2M/Beta-2 microglobulin Protein, Rat (99a.a, HEK293, His)

B2M/Beta-2 microglobulin Protein, Rat (99a.a, HEK293, His)

Cat. No.: HY-P78625
SDS COA Handling Instructions Technical Support

B2M or Beta-2 microglobulin binds to MHC class II protein complexes and forms homodimers. It responds to cadmium ions and exogenous stimuli and is present in the extracellular space. B2M/Beta-2 microglobulin Protein, Rat (HEK293, His) is the recombinant rat-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

B2M or Beta-2 microglobulin binds to MHC class II protein complexes and forms homodimers. It responds to cadmium ions and exogenous stimuli and is present in the extracellular space. B2M/Beta-2 microglobulin Protein, Rat (HEK293, His) is the recombinant rat-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Background

B2M, or Beta-2 microglobulin, is predicted to possess MHC class II protein complex binding activity and protein homodimerization activity. It plays a role in the response to cadmium ion and xenobiotic stimulus, and it is located in the extracellular space. B2M serves as a biomarker for conditions such as acute kidney failure, pyelonephritis, and ureteral obstruction. The human ortholog(s) of this gene have been implicated in various health conditions, including arthritis, familial visceral amyloidosis, immunodeficiency 43, and inflammatory bowel disease. B2M exhibits biased expression in tissues such as the spleen, lung, and nine other tissues, suggesting its involvement in diverse physiological processes.

Biological Activity

Measured in a cell proliferation assay using U251 cells. ED50 this effect is ≤60 ng/mL, corresponding to a specific activity is 16666.667 units/mg.

  • Measured in a cell proliferation assay using U251 cells. The ED50 for this effect is 26.10 ng/mL, corresponding to a specific activity is 38314.1762 units/mg.
Species

Rat

Source

HEK293

Tag

C-His

Accession

NP_036644 (I21-M119)

Gene ID
Molecular Construction
N-term
B2M/Beta-2 microglobulin (I21-M119)
Accession # NP_036644
His
C-term
Synonyms
Beta-2-microglobulin; B2M
AA Sequence

IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM

Molecular Weight

approximately 13 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

B2M/Beta-2 microglobulin Protein, Rat (99a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B2M/Beta-2 microglobulin Protein, Rat (99a.a, HEK293, His)
Cat. No.:
HY-P78625
Quantity:
MCE Japan Authorized Agent: