1. Recombinant Proteins
  2. Fc Receptors
  3. FcRn
  4. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His)

FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His)

Cat. No.: HY-P70881
Handling Instructions Technical Support

The FCGRT protein transfers passive immunity by binding to monomeric IgG and facilitating its uptake from milk. It forms FcRn-IgG complexes that are transcytosed across the intestinal epithelium, releasing IgG into the bloodstream or tissue fluids. This receptor also recycles IgG, prolonging its half-life in circulation. Mechanistically, it binds to monomeric IgG in acidic endosomes, enabling recycling to the cell surface. The FCGRT-B2M heterodimer also regulates albumin homeostasis and consists of p51 and p14 subunits. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His) is a recombinant protein dimer complex containing cynomolgus-derived FCGRT-B2M Heterodimer protein, expressed by HEK293, with C-Flag, C-6*His labeled tag. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His), has molecular weight of 33 & 14 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FCGRT protein transfers passive immunity by binding to monomeric IgG and facilitating its uptake from milk. It forms FcRn-IgG complexes that are transcytosed across the intestinal epithelium, releasing IgG into the bloodstream or tissue fluids. This receptor also recycles IgG, prolonging its half-life in circulation. Mechanistically, it binds to monomeric IgG in acidic endosomes, enabling recycling to the cell surface. The FCGRT-B2M heterodimer also regulates albumin homeostasis and consists of p51 and p14 subunits. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His) is a recombinant protein dimer complex containing cynomolgus-derived FCGRT-B2M Heterodimer protein, expressed by HEK293, with C-Flag, C-6*His labeled tag. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His), has molecular weight of 33 & 14 kDa, respectively.

Background

The FCGRT protein is a cell surface receptor that plays a critical role in transferring passive humoral immunity from the mother to the newborn. It accomplishes this by binding to the Fc region of monomeric immunoglobulin gamma and facilitating its selective uptake from milk. Within the intestinal epithelium, the FCGRT-B2M heterodimer binds to IgG at the apical surface, forming FcRn-IgG complexes that are transcytosed across the epithelium, releasing IgG into the bloodstream or tissue fluids. This receptor continues to contribute to effective humoral immunity throughout life by recycling IgG and prolonging its half-life in circulation. Mechanistically, the binding of monomeric IgG to FCGRT-B2M in acidic endosomes of endothelial and hematopoietic cells enables the recycling of IgG to the cell surface for release into the circulation. Additionally, the FCGRT-B2M heterodimer plays a role in regulating the homeostasis of albumin, the most abundant circulating protein, by interacting with it. The FCGRT-B2M complex consists of two subunits, p51 and p14 (equivalent to beta-2-microglobulin), forming an MHC class I-like heterodimer.

Species

Cynomolgus

Source

HEK293

Tag

C-Flag;C-6*His

Accession

Q8SPV9 (A24-S297)&Q8SPW0 (I21-M119)

Gene ID
Molecular Construction
N-term
B2M (I21-M119)
Accession # Q8SPW0
C-term
N-term
FCGRT (A24-S297)
Accession # Q8SPV9-1
Flag-6*His
C-term
Synonyms
Beta-2-Microglobulin; B2M
AA Sequence

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM&AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSS

Molecular Weight

33&14 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His)
Cat. No.:
HY-P70881
Quantity:
MCE Japan Authorized Agent: