B7-H2/ICOSLG Protein, Human (HEK293, Fc)

B7-H2/ICOSLG Protein, Human (HEK293, Fc) is a polypeptide chain containing the C-termimal human IgG1 Fc fragment produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

As a member of the B7 family, inducible co-stimulator ligand (ICOSLG) expressed on tumor cell has been reported to have an important role in tumor immunity. As the counter ligand of ICOS, a CD28-related molecule, ICOSLG is expressed on professional antigen-presenting cell (APCs; such as dendritic cells (DCs) and B cells) and on some tumor cells (such as glioma cells and gastric carcinoma cells). ICOSLG is the only B7 family member that preferentially co-stimulates type 2T helper cell (Th2) responses, and interestingly, this unique molecule has a critical role in antitumor immunity. ICOSLG expression on solid tumors (implanted-transfected tumors) aids in both NK mediated and CD8⁺ cytotoxic T cell (CTL) activation and killing. Several studies using ICOSLG-transfected solid tumor cell lines found that ICOSLG induced CD8⁺ cytotoxic lymphocyte-mediated tumor regression^[1].

5 µg/mL (100 µL/well) of immoblized recombinant human B7-H2/ICOSLG-Fc can bind human Biotin-B7-H2/ICOSLG-Fc with a linear range of 0.76-12.21 μg/mL.

Human

HEK293

C-hFc

O75144-1 (D19-S258)

23308  [NCBI]

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS

70-80 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, 5% trehalose and mannitol.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48(1):124-8.  [Content Brief]