1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Stimulatory Immune Checkpoint Molecules
  4. B7-H6
  5. B7-H6 Protein, Rat (HEK293, His)

B7-H6, a distinctive monomeric protein, uniquely triggers NCR3-dependent natural killer (NK) cell activation, specifically interacting with NCR3 while avoiding engagement with other NK cell-activating receptors (NCR1, NCR2, and KLRK1). This specificity underscores B7-H6's unique role in initiating NK cell responses through the NCR3 pathway within the intricate network of NK cell activation mechanisms. B7-H6 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H6 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

B7-H6, a distinctive monomeric protein, uniquely triggers NCR3-dependent natural killer (NK) cell activation, specifically interacting with NCR3 while avoiding engagement with other NK cell-activating receptors (NCR1, NCR2, and KLRK1). This specificity underscores B7-H6's unique role in initiating NK cell responses through the NCR3 pathway within the intricate network of NK cell activation mechanisms. B7-H6 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H6 protein, expressed by HEK293 , with C-His labeled tag.

Background

B7-H6, a distinctive protein, serves as a trigger for NCR3-dependent natural killer (NK) cell activation. Operating as a monomer, B7-H6 exhibits a specific interaction with NCR3, distinctly avoiding engagement with other NK cell-activating receptors, such as NCR1, NCR2, and KLRK1. This interaction highlights its unique role in initiating NK cell responses through the NCR3 pathway, showcasing its specificity in the intricate network of NK cell activation mechanisms.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized rat NCR3 at 10 μg/mL can bind rat B7-H6. The ED50 for this effect is 14.43 ng/mL.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

XP_006223356 (M1-S308)

Gene ID
Molecular Construction
N-term
B7-H6 (M1-S308)
Accession # XP_006223356
His
C-term
Synonyms
Natural cytotoxicity triggering receptor 3 ligand 1; B7-H6; NCR3LG1
AA Sequence

MASQSCQRGPENAHMHPKGPCCSALCFLCSLGSSPHGSSLGPLRKCGRRSKPVQSSPEGSRVAEWPDGLLSLLLLLWSLLPSAGGLELEMAGTTQIVFLHEDVTIPCKILGSLHLDLSIVGVIWSLKKDGDESEVFKFYGDQLEAVRPGANVSLLGLEHGDASLYLPRFELWEAGEYQCKVVVTPEKKEGTTRLEVVAHPNMSLSEKPATARGGKEKLIICQLDGFYPEALDIKWMGSALKDSHFQEITEGVVTGPTVKNDDGTFSVTSSLALKPALEDHMYQCVVWHRSWLMPQSLNVTVFENKPRS

Molecular Weight

Approximately 35-46 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

B7-H6 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-H6 Protein, Rat (HEK293, His)
Cat. No.:
HY-P75483
Quantity:
MCE Japan Authorized Agent: