1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily B Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands CD257/BAFF
  5. B-cell Activating Factor (BAFF)
  6. BAFF/TNFSF13B Protein, Canine (HEK293, Fc)

BAFF/TNFSF13B Protein, Canine (HEK293, Fc)

Cat. No.: HY-P75589
COA Handling Instructions

The BAFF/TNFSF13B protein is part of the TNF family and is critical in the regulation of immune responses and cell survival. It is also called B cell activating factor and plays a crucial role in B cell development, activation and survival by binding to receptors such as BAFF-R. BAFF/TNFSF13B Protein, Canine (HEK293, Fc) is the recombinant canine-derived BAFF/TNFSF13B protein, expressed by HEK293 , with N-hFc labeled tag. The total length of BAFF/TNFSF13B Protein, Canine (HEK293, Fc) is 150 a.a., with molecular weight of ~45.5 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $30 In-stock
5 μg $55 In-stock
10 μg $80 In-stock
50 μg $190 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BAFF/TNFSF13B protein is part of the TNF family and is critical in the regulation of immune responses and cell survival. It is also called B cell activating factor and plays a crucial role in B cell development, activation and survival by binding to receptors such as BAFF-R. BAFF/TNFSF13B Protein, Canine (HEK293, Fc) is the recombinant canine-derived BAFF/TNFSF13B protein, expressed by HEK293 , with N-hFc labeled tag. The total length of BAFF/TNFSF13B Protein, Canine (HEK293, Fc) is 150 a.a., with molecular weight of ~45.5 kDa.

Background

The BAFF/TNFSF13B protein belongs to the tumor necrosis factor (TNF) family, a group of cytokines involved in regulating immune responses and cell survival. BAFF/TNFSF13B, also known as B-cell activating factor, plays a crucial role in B-cell development, activation, and survival. It binds to its receptors, including BAFF receptor (BAFF-R), and promotes B-cell proliferation, antibody production, and the maintenance of mature B cells. BAFF/TNFSF13B is particularly important in the development and function of the immune system, as it helps to regulate B-cell homeostasis and immune tolerance. Dysregulation of BAFF/TNFSF13B signaling has been implicated in various autoimmune diseases and B-cell malignancies. Understanding the role of BAFF/TNFSF13B in normal physiology and disease pathology can provide valuable insights into potential therapeutic approaches for conditions involving B-cell dysfunction or dysregulation.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant BCMA Protein is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Canine BAFF. The ED50 for this effect is 4.397 ng/mL.

Species

Canine

Source

HEK293

Tag

N-hFc

Accession

C4NZX1 (A143-L292)

Gene ID

485545  [NCBI]

Molecular Construction
N-term
hFc
BAFF (A143-L292)
Accession # C4NZX1
C-term
Synonyms
Tumor necrosis factor ligand superfamily member 13B; BAFF; TALL-1
AA Sequence

QGPEETVTQDCLQLIADSDTPTIRKGAYTFVPWLLSFKRGRALEEKENKILVKEAGYFFIYSQVLYTDNTFAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPREDAKISRDGDGTFFGALKLL

Molecular Weight

Approximately 45-50 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BAFF/TNFSF13B Protein, Canine (HEK293, Fc)
Cat. No.:
HY-P75589
Quantity:
MCE Japan Authorized Agent: