BAFF/TNFSF13B Protein, Canine (HEK293, Fc)

The BAFF/TNFSF13B protein is part of the TNF family and is critical in the regulation of immune responses and cell survival. It is also called B cell activating factor and plays a crucial role in B cell development, activation and survival by binding to receptors such as BAFF-R. BAFF/TNFSF13B Protein, Canine (HEK293, Fc) is the recombinant canine-derived BAFF/TNFSF13B protein, expressed by HEK293 , with N-hFc labeled tag. The total length of BAFF/TNFSF13B Protein, Canine (HEK293, Fc) is 150 a.a., with molecular weight of ~45.5 kDa.

The BAFF/TNFSF13B protein belongs to the tumor necrosis factor (TNF) family, a group of cytokines involved in regulating immune responses and cell survival. BAFF/TNFSF13B, also known as B-cell activating factor, plays a crucial role in B-cell development, activation, and survival. It binds to its receptors, including BAFF receptor (BAFF-R), and promotes B-cell proliferation, antibody production, and the maintenance of mature B cells. BAFF/TNFSF13B is particularly important in the development and function of the immune system, as it helps to regulate B-cell homeostasis and immune tolerance. Dysregulation of BAFF/TNFSF13B signaling has been implicated in various autoimmune diseases and B-cell malignancies. Understanding the role of BAFF/TNFSF13B in normal physiology and disease pathology can provide valuable insights into potential therapeutic approaches for conditions involving B-cell dysfunction or dysregulation.

Measured by its binding ability in a functional ELISA. When Recombinant BCMA Protein is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Canine BAFF. The ED₅₀ for this effect is 4.397 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant BCMA Protein is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Canine BAFF. The ED₅₀ for this effect is 4.397 ng/mL.

Canine

HEK293

N-hFc

C4NZX1 (A143-L292)

485545  [NCBI]

QGPEETVTQDCLQLIADSDTPTIRKGAYTFVPWLLSFKRGRALEEKENKILVKEAGYFFIYSQVLYTDNTFAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPREDAKISRDGDGTFFGALKLL

Approximately 45-50 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.