BCL2A1 Protein, Human (His)

The BCL2A1 protein plays a critical role in resisting apoptosis triggered by IL-3 deprivation, suggesting its importance in the response of hematopoietic cells to external signals and may be involved in protecting endothelial cell survival during infection. It also inhibits serum starvation-induced apoptosis in mammary epithelial cells (HC11). BCL2A1 Protein, Human (His) is the recombinant human-derived BCL2A1 protein, expressed by E. coli , with N-His labeled tag. The total length of BCL2A1 Protein, Human (His) is 152 a.a., with molecular weight of 16-17 kDa.

The BCL2A1 protein plays a crucial role in retarding apoptosis induced by IL-3 deprivation, suggesting its involvement in the response of hemopoietic cells to external signals and its potential role in maintaining endothelial survival during infection. Additionally, BCL2A1 exhibits the ability to inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11. The protein interacts directly with various key players in the apoptotic pathway, including BAK1, BID, BMF, BBC3, BCL2L11/BIM, BAX isoform Sigma, PMAIP1, RTL10/BOP, ING4, and UBQLN4. This extensive interaction network underscores the multifaceted role of BCL2A1 in modulating apoptotic processes.

Human

E. coli

N-6*His

Q16548 (M1-S152)

597  [NCBI]

MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKS

Approximately 16-17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.