BD-2 Protein, Mouse

BD-2 Protein, Mouse is an anti-microbial peptide that participates in the response to microbial invasion.

Mouse Beta Defensin-2 (mBD2) is produced by mouse urothelium in response to intravesicular BCG as a defense mechanism against BCG, and blocking mBD2 by an anti-mBD2 antibody increased the effectiveness of BCG^[1].

Full biological activity determined by a chemotaxis bioassay using immature human dendritic cells is in a concentration of 10-100 ng/ml.

Mouse

E. coli

Tag Free

P82020 (A21-K71)

13215  [NCBI]

AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK

Approximately 5.5 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kwon JK, et al. Murine β-defensin-2 may regulate the effect of bacillus Calmette-Guérin (BCG) in normal mouse bladder. Urol Oncol. 2015 Mar;33(3):111.e9-16.  [Content Brief]