BD-4 Protein, Human

BD-4 Protein, Human is an inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity.

Human Beta Defensin-4 (hBD-4) expression is up-regulated by infection with gram-positive and gram-negative bacteria in human respiratory epithelial cells, and in response to phorbol 12-myristate 13-acetate, but not in response to other inflammatory factors that up-regulate the expression of hBD-2 or hBD-3. Synthetic hBD-4 exhibits a selective, salt-sensitive spectrum of antimicrobial activity, and it represents one of the most active antimicrobial peptides against Pseudomonas aeruginosa (minimal inhibitory concentration: 4.1 μg/mL) known to date^[1].

Full biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 0.1-100 ng/mL.

Human

E. coli

Tag Free

Q8WTQ1 (E23-P72)

140596  [NCBI]

EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP

Approximately 5-11 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PBS, pH 7.4, 130 mM NaCl or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. García JR, et al. Human beta-defensin 4: a novel inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity. FASEB J. 2001 Aug;15(10):1819-21.  [Content Brief]