1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Beta-lactamase CTX-M-1/Bla Protein, E.coli (His)

Beta-lactamase CTX-M-1/Bla Protein, E.coli (His)

Cat. No.: HY-P71459
SDS COA Handling Instructions Technical Support

Beta-lactamase CTX-M-1/Bla protein is a broad-spectrum beta-lactamase that greatly contributes to antibiotic resistance by hydrolyzing penicillins and cephalosporins (including third-generation drugs). Beta-lactamase CTX-M-1/Bla Protein, E.coli (His) is the recombinant E. coli-derived Beta-lactamase CTX-M-1/Bla protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Beta-lactamase CTX-M-1/Bla protein is a broad-spectrum beta-lactamase that greatly contributes to antibiotic resistance by hydrolyzing penicillins and cephalosporins (including third-generation drugs). Beta-lactamase CTX-M-1/Bla Protein, E.coli (His) is the recombinant E. coli-derived Beta-lactamase CTX-M-1/Bla protein, expressed by E. coli , with N-His labeled tag.

Background

Beta-lactamase CTX-M-1/Bla Protein is a broad-spectrum beta-lactamase that plays a crucial role in antibiotic resistance by conferring resistance to penicillins, as well as first, second, and third-generation cephalosporins. Its enzymatic activity contributes to the hydrolysis of these beta-lactam antibiotics, allowing bacteria to evade the antimicrobial effects of these commonly used drugs. This resistance mechanism poses a significant challenge in the clinical treatment of bacterial infections, emphasizing the importance of understanding and addressing the molecular basis of antibiotic resistance.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

E.coli

Source

E. coli

Tag

N-His

Accession

P28585 (Q29-L291)

Gene ID

/

Molecular Construction
N-term
His
Bla (Q29-L291)
Accession # P28585
C-term
Synonyms
bla; men1Beta-lactamase CTX-M-1; EC 3.5.2.6; Beta-lactamase MEN-1; Cefotaximase 1
AA Sequence

QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

Molecular Weight

Approximately 32.2 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Beta-lactamase CTX-M-1/Bla Protein, E.coli (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Beta-lactamase CTX-M-1/Bla Protein, E.coli (His)
Cat. No.:
HY-P71459
Quantity:
MCE Japan Authorized Agent: