1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Betacellulin
  5. Betacellulin/BTC Protein, Cynomolgus (HEK293, Fc)

Betacellulin/BTC Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P77303
Handling Instructions Technical Support

Betacellulin/BTC Protein, a member of the epidermal growth factor (EGF) family, is known to play an important role in regulating growth and differentiation of pancreatic beta cells. And it is a growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. In addition, BTC exerts potent mitogenic effects on retinal pigment epithelial cells and vascular smooth muscle cells as a monomer. Betacellulin/BTC Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived Betacellulin/BTC protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Betacellulin/BTC Protein, a member of the epidermal growth factor (EGF) family, is known to play an important role in regulating growth and differentiation of pancreatic beta cells. And it is a growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. In addition, BTC exerts potent mitogenic effects on retinal pigment epithelial cells and vascular smooth muscle cells as a monomer. Betacellulin/BTC Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived Betacellulin/BTC protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Betacellulin (BTC), a member of the epidermal growth factor (EGF) family, is known to play an important role in regulating growth and differentiation of pancreatic beta cells. BTC functions as a ligand for the epidermal growth factor receptor (EGFR) and is expressed in a variety of cell types and tissues. And it is a growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. BTC exerts potent mitogenic effects on retinal pigment epithelial cells and vascular smooth muscle cells as a monomer. BTC exerts proliferative activity on beta cells through the activation of ErbB-1 and ErbB-2 receptors, which may increase IRS-2 expression, contributing to the regeneration of beta cells[1].

Biological Activity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.39 ng/mL, corresponding to a specific activity is 7.19×105 units/mg.

  • Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.39 ng/mL, corresponding to a specific activity is 7.19×105 units/mg.
Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

XP_001101880.3 (D32-Y111)

Gene ID

702178  [NCBI]

Molecular Construction
N-term
BTC (D32-Y111)
Accession # XP_001101880.3
hFc
C-term
Synonyms
Btc; Betacellulin; Betacellulin epidermal growth factor family member
AA Sequence

DGNSTRSPETNGLLCGDPDENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVTEQTPSCVCDEGYIGARCERVDLFY

Molecular Weight

Approximately 45-55 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Betacellulin/BTC Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Betacellulin/BTC Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P77303
Quantity:
MCE Japan Authorized Agent: