1. Recombinant Proteins
  2. Others
  3. BIN1 Protein, Human (His)

The BIN1 protein is essential for controlling plasma membrane curvature and shape and is essential for the formation of T-tubules in muscle cells. It acts as a negative regulator of endocytosis and affects intracellular vesicle sorting. BIN1 Protein, Human (His) is the recombinant human-derived BIN1 protein, expressed by E. coli , with N-His labeled tag. The total length of BIN1 Protein, Human (His) is 424 a.a., with molecular weight of ~54 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BIN1 protein is essential for controlling plasma membrane curvature and shape and is essential for the formation of T-tubules in muscle cells. It acts as a negative regulator of endocytosis and affects intracellular vesicle sorting. BIN1 Protein, Human (His) is the recombinant human-derived BIN1 protein, expressed by E. coli , with N-His labeled tag. The total length of BIN1 Protein, Human (His) is 424 a.a., with molecular weight of ~54 kDa.

Background

The BIN1 Protein plays a crucial role in the regulation of plasma membrane curvature, shaping, and remodeling. In muscle cells, it is indispensable for the formation of T-tubules, which are tubular invaginations of the plasma membrane critical for depolarization-contraction coupling. Acting as a negative regulator of endocytosis, BIN1 is also involved in intracellular vesicle sorting and modulates BACE1 trafficking, influencing amyloid-beta production. In neuronal circuits, its role in endocytosis regulation may impact the internalization of PHF-tau aggregates. Furthermore, BIN1 is implicated in the regulation of MYC activity, influencing cell proliferation, and exhibits actin bundling activity, stabilizing actin filaments against depolymerization. BIN1 forms a heterodimer with AMPH, binds to SH3GLB1, interacts with DNM1, SYNJ1, DNM2, AP2A2, AP2B1, MYC, BIN2, SNX4, and BACE1, indicating its involvement in diverse cellular processes and protein-protein interactions.

Species

Human

Source

E. coli

Tag

N-10*His

Accession

O00499-10 (M1-P424)

Gene ID

274  [NCBI]

Molecular Construction
N-term
His
BIN1 (M1-P424)
Accession # O00499-10
C-term
Synonyms
Myc box-dependent-interacting protein 1; BIN1; AMPHL; Amphiphysin II
AA Sequence

MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPRKKSKLFSRLRRKKNSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP

Molecular Weight

Approximately 54 kDa

Purity

Greater than 85% as determined by reducing SDS-PAGE.

Appearance

yophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, 200 mM NaCl, pH 8.0, 10% trehalose, 0.02% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BIN1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BIN1 Protein, Human (His)
Cat. No.:
HY-P74380
Quantity:
MCE Japan Authorized Agent: