BIN1 Protein, Human (His)

The BIN1 protein is essential for controlling plasma membrane curvature and shape and is essential for the formation of T-tubules in muscle cells. It acts as a negative regulator of endocytosis and affects intracellular vesicle sorting. BIN1 Protein, Human (His) is the recombinant human-derived BIN1 protein, expressed by E. coli , with N-His labeled tag. The total length of BIN1 Protein, Human (His) is 424 a.a., with molecular weight of ~54 kDa.

The BIN1 Protein plays a crucial role in the regulation of plasma membrane curvature, shaping, and remodeling. In muscle cells, it is indispensable for the formation of T-tubules, which are tubular invaginations of the plasma membrane critical for depolarization-contraction coupling. Acting as a negative regulator of endocytosis, BIN1 is also involved in intracellular vesicle sorting and modulates BACE1 trafficking, influencing amyloid-beta production. In neuronal circuits, its role in endocytosis regulation may impact the internalization of PHF-tau aggregates. Furthermore, BIN1 is implicated in the regulation of MYC activity, influencing cell proliferation, and exhibits actin bundling activity, stabilizing actin filaments against depolymerization. BIN1 forms a heterodimer with AMPH, binds to SH3GLB1, interacts with DNM1, SYNJ1, DNM2, AP2A2, AP2B1, MYC, BIN2, SNX4, and BACE1, indicating its involvement in diverse cellular processes and protein-protein interactions.

Human

E. coli

N-10*His

O00499-10 (M1-P424)

274  [NCBI]

MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPRKKSKLFSRLRRKKNSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP

Approximately 54 kDa

Greater than 85% as determined by reducing SDS-PAGE.

yophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, 200 mM NaCl, pH 8.0, 10% trehalose, 0.02% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.