BLNK Protein, Human (His)

BLNK Protein, Human (His) expresses in E. coliwith a His tag. B-cell linker protein (BLNK) is an adaptor protein that orchestrates signalling downstream of B-cell receptors^[1].

B-cell linker protein (BLNK), also known as SLP-65, BASH and BCA, is a B-cell adaptor molecule that links the cytoplasmic protein tyrosine kinases (PTKs) with phosphorylation of downstream effector molecules and plays a crucial role in the BCR signalling system^[2].

Human

E. coli

C-6*His

AAH18906 (M1-S456 )

29760  [NCBI]

MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVSHHHHHH

40-80 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Soini L, et al. A biophysical and structural analysis of the interaction of BLNK with 14-3-3 proteins. J Struct Biol. 2020;212(3):107662.  [Content Brief]

  [2]. Taguchi T, et al. Deficiency of BLNK hampers PLC-gamma2 phosphorylation and Ca2+ influx induced by the pre-B-cell receptor in human pre-B cells. Immunology. 2004;112(4):575-582.  [Content Brief]