1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-7
  6. BMP-7 Protein, Human (His)

Bone morphogenetic protein 7 (BMP-7) is a polymorphic ligand protein belonging to the TGF-β family. BMP-7 is involved in regulating the proliferation, invasion and migration of cancer cells and is associated with a variety of human tumors. BMP-7 binds ALK2 or ACVR2A/BMPR2 excitation signal, which is terminated by SMADs regulation. BMP-7 is involved in the BMP-7-SMad1/5/9 signaling pathway, which is associated with the epithelial-mesenchymal transition (EMT) process. BMP-7 also eliminates vascular inflammation, maintains vascular integrity, reduces vascular calcification, and stimulates in situ phosphate ossification deposition. The total length of human BMP-7 protein is 431 amino acids (M1-H431), with 4 glycosylation domains. BMP-7 Protein, Human (His) has a total length of 139 amino acids (S293-H431), is expressed in E. coli cells with a N-terminal 6*His-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Bone morphogenetic protein 7 (BMP-7) is a polymorphic ligand protein belonging to the TGF-β family. BMP-7 is involved in regulating the proliferation, invasion and migration of cancer cells and is associated with a variety of human tumors[1]. BMP-7 binds ALK2 or ACVR2A/BMPR2 excitation signal, which is terminated by SMADs regulation[2]. BMP-7 is involved in the BMP-7-SMad1/5/9 signaling pathway, which is associated with the epithelial-mesenchymal transition (EMT) process[1]. BMP-7 also eliminates vascular inflammation, maintains vascular integrity[3], reduces vascular calcification, and stimulates in situ phosphate ossification deposition[4]. The total length of human BMP-7 protein is 431 amino acids (M1-H431), with 4 glycosylation domains. BMP-7 Protein, Human (His) has a total length of 139 amino acids (S293-H431), is expressed in E. coli cells with a N-terminal 6*His-tag.

Background

Bone Morphogenetic Protein 7 (BMP-7) is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-7 is involved in regulating the proliferation, invasion and migration of cancer cells, associated with a variety of human tumors[1].
BMP-7 also appears to exhibit anti-inflammatory effects on the vasculature, and may function to maintain vascular integrity[3].
BMP-7 attenuates vascular calcification, but also corrects hyperphosphatemia associated with uremia, and stimulates orthotopic skeletal phosphate deposition while simultaneously preventing vascular calcification by direct action on vascular smooth muscle cells[4].
BMP/TGFβ signaling to involve in vascular and valvular homeostasis, which is a critical process of embryonic development[5].
BMP-7 inhibits primary human aortic smooth muscle cells (SMCs) proliferation due to stimulation with serum, platelet-derived growth factor subunit BB (PDGF-BB) or TGFβ1, and maintains the expression of the vascular SMC phenotype[3].
And BMP/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms[2].
However, BMP-7 knockdown results the expression of p-Smad1/5/9 significantly decreased, accompanied with BMP-7-Smad1/5/9 signaling pathway inactive and epithelial-mesenchymal transition (EMT) process reverse[1].
In lung cancer, BMP-7 inhibits bone metastasis, and induces apoptosis and cell cycle arrest. In malignant melanoma, BMP-7 can induce mesenchymal-epithelial transformation and inhibit the metastasis of cancer cells. BMP-7 inhibit epithelial-mesenchymal transition (EMT)-related genes and cell invasion, inhibit telomerase, shorten telomeres, and induce the aging and apoptosis of breast cancer cells. BMP-7 has also been found to increase the cell proliferation and migration potential in a model of metastatic breast cancer in the bone and prostate cancer[1].
BMP-7 is widely found in different animals, while the sequence in mouse is highly similar to rat (100.00%), and human (97.67%).

In Vitro

BMP-7 (300 ng/mL) initiates a synchronous wave of differentiation occurred, characterized by flattened, enlarged cells with reduced proliferation[6].
BMP-7 (50 ng/mL; 1, 3, 5, 7, and 17 d) induces SCG neurons dendritic growth[7].

Biological Activity

Recombinant human BMP-7 induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is <0.5 μg/mL, corresponding to a specific activity is 2×103 units/mg.

  • Recombinant human BMP-7 induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 0.2189 μg/mL, corresponding to a specific activity is 4.568×103 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P18075 (S293-H431)

Gene ID

655  [NCBI]

Molecular Construction
N-term
6*His
BMP-7 (S293-H431)
Accession # P18075
C-term
Synonyms
rHuBMP-7; OP-1
AA Sequence

STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

Molecular Weight

Approximately 17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 500 mM arginine, pH 8.0 or 0.1% TFA, 20% Acetonitrile, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMP-7 Protein, Human (His)
Cat. No.:
HY-P7008A
Quantity:
MCE Japan Authorized Agent: