BOC Protein, Human (HEK293, His)

BOC Protein, Human (HEK293, His) is a recombinant human BOC produced in HEK293 cells. BOC is a receptor-like protein that, with the related factor CDO, belongs to a newly recognized subfamily within the immunoglobulin superfamily of cell-surface molecules. BOC and CDO form complexes that positively regulate myogenesis in vitro^[1].

BOC is a member of the Ig/FNIII repeat family of receptor-like proteins. BOC has a four Ig plus three FNIII structure in its ectodomain, but is much more closely related to CDO at the amino acid level than are the Robo axon guidance receptors, despite the latter sharing a 5 + 3 structure with CDO^[2].

Human

HEK293

C-6*His

Q96DN7 (A30-S157)

91653  [NCBI]

ADLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYSHHHHHH

20-38 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Kang JS, et al. BOC, an Ig superfamily member, associates with CDO to positively regulate myogenic differentiation. EMBO J. 2002;21(1-2):114-124.  [Content Brief]

  [2]. Mulieri PJ, et al. Expression of the boc gene during murine embryogenesis. Dev Dyn. 2002;223(3):379-388.  [Content Brief]